Protein Info for RR42_RS12560 in Cupriavidus basilensis FW507-4G11

Annotation: phosphate starvation protein PhoH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 573 PF13638: PIN_4" amino acids 114 to 259 (146 residues), 123.1 bits, see alignment E=1.5e-39 PF02562: PhoH" amino acids 360 to 560 (201 residues), 160.1 bits, see alignment E=8.2e-51

Best Hits

KEGG orthology group: K07175, PhoH-like ATPase (inferred from 89% identity to cti:RALTA_A1814)

Predicted SEED Role

"Predicted ATPase related to phosphate starvation-inducible protein PhoH" in subsystem Phosphate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YCR3 at UniProt or InterPro

Protein Sequence (573 amino acids)

>RR42_RS12560 phosphate starvation protein PhoH (Cupriavidus basilensis FW507-4G11)
MPLPTMPAKPAQLLDPSEFAPVTKLTKAKSASQGKKPVPALERVALLETGTSKAENAPAV
VASASGSTRARTKDAPPSALKSVPSLAAVPKAPAKAPGTTNRRMQKHTGPSKLFVLDTNV
LMHDPSSLFRFEEHDVYLPMMTLEELDNHKKGMSEVARNARTVSRTLDALVGGTDGVLDD
GLPLAKLGNRDAQGKLFLQTKLNEIKLPDGLPQGKADNQILGVVSALQQQFPERQVVLVS
KDINMRIKARALGLPAEDYFNDQVLEDKDLLYSGVMLLPNDFWAKHGKGVESWQDPKSGA
MFYRLTGPLVPSFLVNQFVFLEPSDGSLPLYAQVKEINGKTALLQTLKDYTHHKNNVWSV
TARNREQNFALNLLMHPEIDFVTLLGQAGTGKTLLALAAGLEQVLDQKLYNEIIVTRATV
PVGEDIGFLPGTEEEKMQPWMGAFDDNLEVLQKSDDSAGEWGRAATQELIRSRIKVKSMN
FMRGRTFVNKFVIIDEAQNLTPKQMKTLVTRAGPGTKIICLGNIAQIDTPYLTEGSSGLT
YVVDRFKGWSHSGHVTLARGERSRLADHAADVL