Protein Info for RR42_RS12535 in Cupriavidus basilensis FW507-4G11

Annotation: threonine synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 482 PF14821: Thr_synth_N" amino acids 2 to 79 (78 residues), 100.1 bits, see alignment E=6.4e-33 PF00291: PALP" amino acids 99 to 346 (248 residues), 42.4 bits, see alignment E=6e-15 TIGR00260: threonine synthase" amino acids 108 to 445 (338 residues), 223 bits, see alignment E=3e-70

Best Hits

Swiss-Prot: 70% identical to THRC_METGL: Threonine synthase (thrC) from Methylobacillus glycogenes

KEGG orthology group: K01733, threonine synthase [EC: 4.2.3.1] (inferred from 92% identity to reh:H16_A2265)

Predicted SEED Role

"Threonine synthase (EC 4.2.3.1)" in subsystem Threonine and Homoserine Biosynthesis (EC 4.2.3.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.3.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YCQ7 at UniProt or InterPro

Protein Sequence (482 amino acids)

>RR42_RS12535 threonine synthase (Cupriavidus basilensis FW507-4G11)
MKYQSTRGHEMPQTFSEILLGGLAPDGGLYLPREYPQVTADELEAWRKLSYADLAFEVLS
RFCDDIPAEDLRALTRKTYTAEVYCNARPGDNTADITPLRTLGEEGGTQLQLLGLSNGPT
LAFKDMAMQLLGNLFEYALARAGQELNILGATSGDTGSAAEYAMRGKRGIRVFMLSPHRK
MSAFQTAQMFSLQDPNIFNLAVEGVFDDCQDIVKAVSNDLGYKARQKIGTVNSINWARVV
AQVVYYFKGWLLATDGPGQKVSFCVPSGNFGNVCAGHIARMMGLPIDKLVVATNENDVLD
EFFRTGTYRVRKSAETYHTSSPSMDISKASNFERFVFDLLGRDGDKLAKMFREDVDTKGG
FDLSGTPEFERIRAFGFVSGRSTHEDRLATIRDLSERYGITIDTHTADGIKVAREHLTPG
VPMLVLETALPAKFADTIRAALGHEPERPAAFEGIENLPQRFEVMPADADRIKAYIAGHT
GL