Protein Info for RR42_RS12525 in Cupriavidus basilensis FW507-4G11

Annotation: molybdenum cofactor biosynthesis protein MoaD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01682: molybdopterin converting factor, subunit 1
  • amino acids 3 to 85 (83 residues), 85.8 bits, E=1.4e-28
• PF02597: ThiS
  • amino acids 6 to 85 (80 residues), 65.5 bits, E=2.6e-22

Best Hits

Swiss-Prot: 46% identical to MOAD_ECOLI: Molybdopterin synthase sulfur carrier subunit (moaD) from Escherichia coli (strain K12)

KEGG orthology group: K03636, molybdopterin synthase sulfur carrier subunit (inferred from 78% identity to reu:Reut_A1990)

MetaCyc: 46% identical to molybdopterin synthase sulfur carrier subunit (Escherichia coli K-12 substr. MG1655)
RXN-8342 [EC: 2.8.1.12]

Predicted SEED Role

"Molybdenum cofactor biosynthesis protein MoaD" in subsystem Molybdenum cofactor biosynthesis

MetaCyc Pathways

• molybdopterin biosynthesis (4/6 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.8.1.12

Sequence Analysis Tools

See A0A0C4Y3T6 at UniProt or InterPro

Protein Sequence (85 amino acids)

>RR42_RS12525 molybdenum cofactor biosynthesis protein MoaD (Cupriavidus basilensis FW507-4G11)
MNIELRFFASVREQLGLGQERVAVPAEVATVADLRHWLGARGGAWAEVLAEGRALRMAVD
HEVASADSVLAEGCEVAFFPPVTGG