Protein Info for RR42_RS12515 in Cupriavidus basilensis FW507-4G11

Annotation: camphor resistance protein CrcB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 126 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details transmembrane" amino acids 38 to 57 (20 residues), see Phobius details amino acids 68 to 85 (18 residues), see Phobius details amino acids 99 to 122 (24 residues), see Phobius details TIGR00494: protein CrcB" amino acids 8 to 120 (113 residues), 92.7 bits, see alignment E=9.8e-31 PF02537: CRCB" amino acids 8 to 119 (112 residues), 92.4 bits, see alignment E=1e-30

Best Hits

Swiss-Prot: 87% identical to CRCB_CUPTR: Putative fluoride ion transporter CrcB (crcB) from Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CIP 107171 / LMG 19424 / R1)

KEGG orthology group: K06199, CrcB protein (inferred from 87% identity to cti:RALTA_A1805)

MetaCyc: 46% identical to F- channel (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-498

Predicted SEED Role

"Protein crcB homolog"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YAE5 at UniProt or InterPro

Protein Sequence (126 amino acids)

>RR42_RS12515 camphor resistance protein CrcB (Cupriavidus basilensis FW507-4G11)
MGALGFVAVGVGAAVGAWLRWAFSVLWNAANPALPYGTLTANLVGGYLIGLAVGFFGAHT
ELPPEWRLLAVTGFLGGLTTFSTFSSEVVGNLIAGDYGWAAVHLLAHLGGSLLLTALGLW
TYRLLA