Protein Info for RR42_RS12390 in Cupriavidus basilensis FW507-4G11

Annotation: transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 170 transmembrane" amino acids 6 to 22 (17 residues), see Phobius details amino acids 29 to 49 (21 residues), see Phobius details amino acids 56 to 75 (20 residues), see Phobius details amino acids 86 to 104 (19 residues), see Phobius details amino acids 115 to 135 (21 residues), see Phobius details amino acids 144 to 165 (22 residues), see Phobius details PF02293: AmiS_UreI" amino acids 1 to 167 (167 residues), 204.6 bits, see alignment E=5.6e-65

Best Hits

Swiss-Prot: 53% identical to AMIS_PSEAE: Putative transporter protein AmiS (amiS) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: None (inferred from 68% identity to har:HEAR1450)

Predicted SEED Role

"Urea channel UreI" in subsystem Urea decomposition

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YCM3 at UniProt or InterPro

Protein Sequence (170 amino acids)

>RR42_RS12390 transporter (Cupriavidus basilensis FW507-4G11)
MLGLTLLYVGAVLCLNGLWLLGKIGDREIWVVNIFAGGVTMLVSLRLIFGGEADSASIKA
GALTLLFTFTYLWVALNRFNGADGRGLGWFSLFVSITVIPVAIDALRHANSVWDTWFAWC
WVGWGVLWFLYFLLLAMQRPILKFTGVATVLAGIATGWLPGYLLLSESFR