Protein Info for RR42_RS12370 in Cupriavidus basilensis FW507-4G11

Annotation: trans-aconitate methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 256 PF13489: Methyltransf_23" amino acids 14 to 150 (137 residues), 70.4 bits, see alignment E=4.5e-23 PF13847: Methyltransf_31" amino acids 34 to 140 (107 residues), 52.2 bits, see alignment E=1.8e-17 PF01135: PCMT" amino acids 34 to 130 (97 residues), 21.6 bits, see alignment E=4.9e-08 PF08241: Methyltransf_11" amino acids 35 to 127 (93 residues), 55 bits, see alignment E=3.2e-18 PF13649: Methyltransf_25" amino acids 35 to 123 (89 residues), 57.7 bits, see alignment E=4.8e-19 PF08242: Methyltransf_12" amino acids 35 to 125 (91 residues), 60.1 bits, see alignment E=8.7e-20

Best Hits

Swiss-Prot: 56% identical to TAM_NITWN: Trans-aconitate 2-methyltransferase (tam) from Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255)

KEGG orthology group: K00598, trans-aconitate 2-methyltransferase [EC: 2.1.1.144] (inferred from 70% identity to reu:Reut_A3459)

Predicted SEED Role

"Trans-aconitate 2-methyltransferase (EC 2.1.1.144)" (EC 2.1.1.144)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.144

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YAB1 at UniProt or InterPro

Protein Sequence (256 amino acids)

>RR42_RS12370 trans-aconitate methyltransferase (Cupriavidus basilensis FW507-4G11)
MTWSAKQYVKFENERTRPVRDLLAAVPGREPRVAVDIGCGPGNSTEVLAACFPGASVTGL
DSSADMVEAARKRLPALKFEVSRIETWYDPGPYDVILANAVLQWLPDHGRLLPALAAKLA
PGGSLAIQVPDTLDTPAHRLMREVAADGPWAGKLAAASQARTGLQGAGWYYELLRAHCGA
VDVWHTTYHHALAGGPAAIVEWFKGTGLRPFLDPLDEAERAAYLERYTAQVARAYRPMED
GTVLLPFPRFFIVATR