Protein Info for RR42_RS12260 in Cupriavidus basilensis FW507-4G11

Annotation: sulfate transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 314 transmembrane" amino acids 36 to 64 (29 residues), see Phobius details amino acids 88 to 113 (26 residues), see Phobius details amino acids 129 to 152 (24 residues), see Phobius details amino acids 159 to 183 (25 residues), see Phobius details amino acids 212 to 233 (22 residues), see Phobius details amino acids 240 to 261 (22 residues), see Phobius details amino acids 269 to 293 (25 residues), see Phobius details TIGR00969: sulfate ABC transporter, permease protein" amino acids 32 to 295 (264 residues), 333.5 bits, see alignment E=1e-103 TIGR02139: sulfate ABC transporter, permease protein CysT" amino acids 36 to 299 (264 residues), 428.1 bits, see alignment E=1.4e-132 PF00528: BPD_transp_1" amino acids 102 to 296 (195 residues), 76.8 bits, see alignment E=9e-26

Best Hits

Swiss-Prot: 53% identical to CYST_SYNE7: Sulfate transport system permease protein CysT (cysT) from Synechococcus elongatus (strain PCC 7942)

KEGG orthology group: K02046, sulfate transport system permease protein (inferred from 88% identity to reh:H16_A2239)

MetaCyc: 52% identical to sulfate/thiosulfate ABC transporter inner membrane subunit CysU (Escherichia coli K-12 substr. MG1655)
ABC-19-RXN [EC: 7.3.2.5]; ABC-7-RXN [EC: 7.3.2.5, 7.3.2.3]; 7.3.2.3 [EC: 7.3.2.5, 7.3.2.3]; TRANS-RXN0-478 [EC: 7.3.2.5, 7.3.2.3]; TRANS-RXN0-479 [EC: 7.3.2.5, 7.3.2.3]

Predicted SEED Role

"Sulfate transport system permease protein CysT" in subsystem Cysteine Biosynthesis

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.3.2.3 or 7.3.2.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YAB2 at UniProt or InterPro

Protein Sequence (314 amino acids)

>RR42_RS12260 sulfate transporter (Cupriavidus basilensis FW507-4G11)
MPPSISLADNPPPARPDAPQARKSAPPKPGKQRFTVLPGFGLSLGFTLFYLTLIVLIPLS
ATFLKTFTMTWEAFWAAVSSPRVVASLQLSFGASLIAAIVNTVFGLIVAWVLVRYRFPGK
RLVDALVDLPFALPTAVAGIALTALFAGNGWIGRYLEPLGIKVAFTPLGVVVALTFIGLP
FVVRTVQPVLEDAEQELEEAAASLGATRLQTFVRVILPTILPALLTGFALSFARGTGEYG
SVVFISGNMPMVSEIAPLMIYSKLEQYDYAGATAVAVVMLVISFALLLLINLLQAWTRRH
HQAVRASVSPDKES