Protein Info for RR42_RS12215 in Cupriavidus basilensis FW507-4G11

Annotation: ribonuclease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 165 TIGR01935: RraA family" amino acids 5 to 158 (154 residues), 214.3 bits, see alignment E=3.4e-68 PF03737: RraA-like" amino acids 5 to 158 (154 residues), 150.9 bits, see alignment E=1.7e-48

Best Hits

Swiss-Prot: 81% identical to RRAAH_CUPNJ: Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase (Reut_A1963) from Cupriavidus necator (strain JMP 134 / LMG 1197)

KEGG orthology group: K02553, regulator of ribonuclease activity A (inferred from 81% identity to reu:Reut_A1963)

Predicted SEED Role

"Ribonuclease E inhibitor RraA" in subsystem RNA processing and degradation, bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YCI6 at UniProt or InterPro

Protein Sequence (165 amino acids)

>RR42_RS12215 ribonuclease (Cupriavidus basilensis FW507-4G11)
MSFATTDLCDANEARLADGSLRVLSPVFQHFGKRAAFSGPAATLKVFEDNSLVRETVESP
GNGRVLVVDGGGSLRCALVGGNLGVLAEKNGWVGILVNGCVRDSGELAVCDIGVRALALH
PQKSQKRNVGEREVTVQMPGAVVRPGNWIYADADGVLVADTRLEG