Protein Info for RR42_RS12030 in Cupriavidus basilensis FW507-4G11

Annotation: DNA repair protein RadA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 453 TIGR00416: DNA repair protein RadA" amino acids 1 to 446 (446 residues), 645.5 bits, see alignment E=2.2e-198 PF18073: Rubredoxin_2" amino acids 8 to 35 (28 residues), 43.2 bits, see alignment (E = 7.4e-15) PF13481: AAA_25" amino acids 64 to 217 (154 residues), 63 bits, see alignment E=9.2e-21 PF06745: ATPase" amino acids 70 to 140 (71 residues), 43.7 bits, see alignment E=6.7e-15 PF03796: DnaB_C" amino acids 70 to 212 (143 residues), 28.3 bits, see alignment E=3.4e-10 PF13401: AAA_22" amino acids 87 to 212 (126 residues), 29.6 bits, see alignment E=2.4e-10

Best Hits

Swiss-Prot: 59% identical to RADA_ECOLI: DNA repair protein RadA (radA) from Escherichia coli (strain K12)

KEGG orthology group: K04485, DNA repair protein RadA/Sms (inferred from 91% identity to cti:RALTA_A1733)

Predicted SEED Role

"DNA repair protein RadA" in subsystem DNA repair, bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YGL1 at UniProt or InterPro

Protein Sequence (453 amino acids)

>RR42_RS12030 DNA repair protein RadA (Cupriavidus basilensis FW507-4G11)
MAKPKNVYTCTECGGTSPRWQGQCPQCQQWNTLVESVAETPSTKRFQPLAASAMVQRLSE
IDAADVPRFSSGIEEFDRVLGGGLVSGGVVLIGGDPGIGKSTLLLQALANLSAQRRVLYV
SGEESGAQIALRAQRLGVDSPHLALLAEIQLEKIQATLEVEKPEVAVIDSIQTLFSDALT
SAPGSVAQVRECAAQLTRIAKSTGTTIILVGHVTKDGSLAGPRVLEHIVDTVLYFEGDTH
SSHRLIRAFKNRFGAVNELGVFAMTERGLRGVSNPSALFLSQHEQVVPGSCVLVTQEGTR
PLLVEVQALVDTANVPNPRRLAVGLEQNRLAMLLAVLHRHAGIACFDQDVFLNAVGGVKI
TEPAADLAVLLAIHSSMRNKPLPRGLVVFGEIGLAGEIRPSPRGQDRLREAAKLGFSIAV
IPKANAPKQKIEGLEVIAVERLEQAIDRVRHME