Protein Info for RR42_RS11950 in Cupriavidus basilensis FW507-4G11

Annotation: succinyl-diaminopimelate desuccinylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 383 TIGR01246: succinyl-diaminopimelate desuccinylase" amino acids 6 to 381 (376 residues), 517 bits, see alignment E=1.3e-159 PF01546: Peptidase_M20" amino acids 70 to 379 (310 residues), 154.1 bits, see alignment E=4.8e-49 PF07687: M20_dimer" amino acids 183 to 290 (108 residues), 104.7 bits, see alignment E=2.6e-34

Best Hits

Swiss-Prot: 92% identical to DAPE_CUPMC: Succinyl-diaminopimelate desuccinylase (dapE) from Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)

KEGG orthology group: K01439, succinyl-diaminopimelate desuccinylase [EC: 3.5.1.18] (inferred from 92% identity to rme:Rmet_1420)

MetaCyc: 59% identical to succinyl-diaminopimelate desuccinylase (Escherichia coli K-12 substr. MG1655)
Succinyl-diaminopimelate desuccinylase. [EC: 3.5.1.18]

Predicted SEED Role

"N-succinyl-L,L-diaminopimelate desuccinylase (EC 3.5.1.18)" in subsystem Arginine Biosynthesis extended or Lysine Biosynthesis DAP Pathway (EC 3.5.1.18)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.5.1.18

Use Curated BLAST to search for 3.5.1.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YA33 at UniProt or InterPro

Protein Sequence (383 amino acids)

>RR42_RS11950 succinyl-diaminopimelate desuccinylase (Cupriavidus basilensis FW507-4G11)
MNPTLALTEDLIRRRSVTPADEGCQAVLETRLKALGFACEAIVSGPDDFRVTNLWAVKRG
TRGQDGKLLAFAGHTDVVPTGPLEQWGSDPFLPSHRDGKLYGRGAADMKTSIAGFVVAVE
EFVQAHPDHAGSIAFLITSDEEGPAHDGTVKVVQALKARGERLDYCVIGEPTSVDTLGDM
VKNGRRGSLSGKLTVKGVQGHIAYPHLARNPIHLAAPALTDLVNERWDEGNEYFPATSWQ
MSNIHGGTGATNVIPGHVTVDFNFRFSTASTPDGLKARVHAILERHQLDYDLDWTLGGEP
FLTARGDLSEALAGAIAAETGVKTELSTTGGTSDGRFIAKICPQVIEFGPPNASIHKIDE
HVEVRFIEPLKNIYRGVLERLIA