Protein Info for RR42_RS11925 in Cupriavidus basilensis FW507-4G11

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 326 transmembrane" amino acids 21 to 39 (19 residues), see Phobius details amino acids 45 to 68 (24 residues), see Phobius details amino acids 78 to 98 (21 residues), see Phobius details amino acids 104 to 125 (22 residues), see Phobius details amino acids 133 to 150 (18 residues), see Phobius details amino acids 162 to 181 (20 residues), see Phobius details amino acids 195 to 215 (21 residues), see Phobius details amino acids 221 to 248 (28 residues), see Phobius details amino acids 260 to 279 (20 residues), see Phobius details amino acids 285 to 304 (20 residues), see Phobius details PF00892: EamA" amino acids 23 to 149 (127 residues), 30.9 bits, see alignment E=1.4e-11 amino acids 166 to 299 (134 residues), 36 bits, see alignment E=3.8e-13

Best Hits

KEGG orthology group: None (inferred from 80% identity to reu:Reut_A1890)

Predicted SEED Role

"PROBABLE TRANSMEMBRANE PROTEIN"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YA29 at UniProt or InterPro

Protein Sequence (326 amino acids)

>RR42_RS11925 hypothetical protein (Cupriavidus basilensis FW507-4G11)
MSHLPATSTASAPADPHAFKSTLSILLGASVWGIAWFPYRVLAGWGLGGMTAAALVSAMA
ALIALVAFARHLGGLRWSWLFVAIGLAAGVTNAGFVWGSVNGHVMRVLLLFYLTPVWTAL
FARVFLGEKLSASGLLLVVLALFGAGLMLWTPEVGLPLPTRAAEWSGLIGGMGFAVNNVL
SRRAGQLYPEMDARLRTVMVYVGCTAVGLPCALLLEPGGVALAPVIGWGGVALMLGLAAT
LVLSNSVVQYGLQRLPANRVSLLMLFEIVIAAVSSWWLATETLSWKEAAGGLCIVAAGAL
SGLVHRTKARRAGNAAGVADQALQPQ