Protein Info for RR42_RS11475 in Cupriavidus basilensis FW507-4G11

Annotation: pyrroloquinoline quinone biosynthesis protein PqqE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 386 TIGR02109: coenzyme PQQ biosynthesis enzyme PqqE" amino acids 19 to 359 (341 residues), 526.6 bits, see alignment E=2.9e-162 PF04055: Radical_SAM" amino acids 28 to 181 (154 residues), 75.1 bits, see alignment E=7.5e-25 TIGR04085: radical SAM additional 4Fe4S-binding SPASM domain" amino acids 253 to 344 (92 residues), 32 bits, see alignment E=1.3e-11 PF13186: SPASM" amino acids 254 to 317 (64 residues), 35.8 bits, see alignment E=7.9e-13

Best Hits

Swiss-Prot: 58% identical to PQQE_AZOVD: PqqA peptide cyclase (pqqE) from Azotobacter vinelandii (strain DJ / ATCC BAA-1303)

KEGG orthology group: K06139, pyrroloquinoline quinone biosynthesis protein E (inferred from 86% identity to reh:H16_B1049)

MetaCyc: 58% identical to glutamate Cgamma--tyrosine C3 ligase (Klebsiella pneumoniae)
RXN-11176 [EC: 1.21.98.4]

Predicted SEED Role

"Coenzyme PQQ synthesis protein E" in subsystem Coenzyme PQQ synthesis or Pyrroloquinoline Quinone biosynthesis

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.21.98.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YC22 at UniProt or InterPro

Protein Sequence (386 amino acids)

>RR42_RS11475 pyrroloquinoline quinone biosynthesis protein PqqE (Cupriavidus basilensis FW507-4G11)
MPSNAAGWSEPPAAMAPPGPPLWLLAELTYRCPLHCAFCSNPVDYARHDAELDTAQWRDV
FTQARALGAVQLGLSGGEPLLRKDLETLVGHAHGLGFYTNLITSGIGLTDARLAALRVAG
LDHIQLSFQDSTRELNDFLSSTRTFDLKQRVARLIKAHGYPMVMNCVLHRHNLPHVGAII
EMALEMGAEYLELANTQYYGWAWENRQALMPTHEQLREAEAVVNAYRARIGNRCKILFVV
PDYFEQRPKKCMNGWGTTFLGVAPDGVALPCHAARMLPGLDLPNVTTRSLREIWRDSDAF
QRFRGTHWLPQPCRSCDSQAQDHGGCRCQAFLLTGDAAAMDPVCDRSGEHGKVMEIVLQG
RLAEAQARTREHGMVFRSDGNSLRLS