Protein Info for RR42_RS11355 in Cupriavidus basilensis FW507-4G11

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 433 transmembrane" amino acids 13 to 36 (24 residues), see Phobius details amino acids 48 to 71 (24 residues), see Phobius details amino acids 77 to 124 (48 residues), see Phobius details amino acids 137 to 159 (23 residues), see Phobius details amino acids 167 to 186 (20 residues), see Phobius details amino acids 211 to 236 (26 residues), see Phobius details amino acids 256 to 278 (23 residues), see Phobius details amino acids 291 to 310 (20 residues), see Phobius details amino acids 316 to 340 (25 residues), see Phobius details amino acids 351 to 374 (24 residues), see Phobius details amino acids 385 to 406 (22 residues), see Phobius details PF07690: MFS_1" amino acids 16 to 330 (315 residues), 119.3 bits, see alignment E=9e-39

Best Hits

KEGG orthology group: None (inferred from 54% identity to reu:Reut_B4313)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4Y3D4 at UniProt or InterPro

Protein Sequence (433 amino acids)

>RR42_RS11355 MFS transporter (Cupriavidus basilensis FW507-4G11)
MTPSYQPVMAWRTALLLVVYMVINFADKIAVGLLAVPMMTELNLSPAQFGLIGSSFFWLF
AIGGITGGFMANRLPTTGILLVMALAWSALQVPMAMSSSLAVLVAARVLLGAAEGPAWPV
AVHACYKWFPNEKRELPVACLAQGGAIGLLLAGMAMPLVSAHWGWRANFYALAVIGFAWT
LLWVAFGKEGRGAEAENSEQRETMHVPYRTLLAEPTVAACIAMKFVSYWGLALTLTWLPA
YLQKGLGYGAVESGRLYAGLIATSLPISVAGSWLVRQLLARGVSSRTARGRVAATVVAIG
GVACMLVWLGGLPPLWRAALIGLTLGLTQIMYAVGPAILAEVVPVSQRGGILAIDNSIAS
FAGVLAPLVTGFLVQGMTGSQGYEAGFAICGLLMVAGALAGAVAIDPARAALSVRRRATV
GCAYAGQAPASSH