Protein Info for RR42_RS11330 in Cupriavidus basilensis FW507-4G11

Annotation: aldehyde dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00171: Aldedh
  • amino acids 13 to 469 (457 residues), 546.6 bits, E=2.1e-168

Best Hits

Swiss-Prot: 52% identical to SAPD_PSESP: 3-succinoylsemialdehyde-pyridine dehydrogenase (ald) from Pseudomonas sp.

KEGG orthology group: None (inferred from 93% identity to reh:H16_A1919)

MetaCyc: 41% identical to aldehyde dehydrogenase (Pseudomonas sp. KIE171)
RXN-8945; RXN-8946

Predicted SEED Role

"Betaine aldehyde dehydrogenase (EC 1.2.1.8)" in subsystem Choline and Betaine Uptake and Betaine Biosynthesis (EC 1.2.1.8)

MetaCyc Pathways

• choline-O-sulfate degradation (3/3 steps found)
• choline degradation I (2/2 steps found)
• glycine betaine biosynthesis I (Gram-negative bacteria) (2/2 steps found)
• glycine betaine biosynthesis II (Gram-positive bacteria) (2/2 steps found)
• glycine betaine biosynthesis III (plants) (2/3 steps found)
• β-alanine biosynthesis I (1/2 steps found)
• β-alanine biosynthesis IV (1/2 steps found)
• choline degradation IV (2/4 steps found)
• dimethylsulfoniopropanoate biosynthesis I (Wollastonia) (1/3 steps found)
• dimethylsulfoniopropanoate biosynthesis II (Spartina) (1/4 steps found)
• isopropylamine degradation (2/7 steps found)

KEGG Metabolic Maps

• Glycine, serine and threonine metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.2.1.8

Use Curated BLAST to search for 1.2.1.8

Sequence Analysis Tools

See A0A0C4Y3D0 at UniProt or InterPro

Protein Sequence (477 amino acids)

>RR42_RS11330 aldehyde dehydrogenase (Cupriavidus basilensis FW507-4G11)
MQQRDKLFINGKWVAPHGTGLINVIHSTTEAVMGRIPEGHARDAEDAIQAARAAFDSWSA
TPPSVRAGYIRKIAEGLKARSEELAQLIAGEVGMPIKMARAIQVGGPVYNWAQAAKLLDT
FAFEEEVGNSLVVREPVGVVAAITPWNYPLNQITLKVAPALAAGCTVVLKPSEVAPLNAF
VLAEVIEAAGLPPGVFNLVTGYGPVVGEVLASHPEVDMVSFTGSTRAGKRVSELGAQSVK
RVALELGGKSASVILDDADLAAAVKGTVGACFLNSGQTCSAHTRMLVPRARYDEVKAIAR
KVVEGYTVGDPLLESSRLGPLISAAQKDRVTGYIQRGINEGAELVAGGPEAPEGLDKGFF
VKPTVLGNVDPKATVAQEEIFGPVLSIICYDTEEDAVRIANDSIYGLGGGVWSGDEARAI
RVARRIRTGQVDINGGPFNMQAPFGGYKQSGNGREAGKYGLEEFLEYKSLQMKKPAA