Protein Info for RR42_RS11300 in Cupriavidus basilensis FW507-4G11

Annotation: epimerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01370: Epimerase
  • amino acids 5 to 163 (159 residues), 72.5 bits, E=9.1e-24
• PF01073: 3Beta_HSD
  • amino acids 8 to 121 (114 residues), 30.6 bits, E=4.4e-11
• PF13460: NAD_binding_10
  • amino acids 8 to 112 (105 residues), 34.1 bits, E=6.3e-12
• PF16363: GDP_Man_Dehyd
  • amino acids 8 to 161 (154 residues), 41.6 bits, E=2.8e-14
• PF07993: NAD_binding_4
  • amino acids 54 to 171 (118 residues), 20.8 bits, E=4.9e-08

Best Hits

Swiss-Prot: 43% identical to URODH_PSESM: Uronate dehydrogenase (udh) from Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)

KEGG orthology group: None (inferred from 72% identity to bug:BC1001_5589)

MetaCyc: 43% identical to uronic acid dehydrogenase subunit (Pseudomonas syringae)
Uronate dehydrogenase. [EC: 1.1.1.203]; 1.1.1.203 [EC: 1.1.1.203]

Predicted SEED Role

"UDP-glucose 4-epimerase (EC 5.1.3.2)" in subsystem Lacto-N-Biose I and Galacto-N-Biose Metabolic Pathway or Lactose and Galactose Uptake and Utilization or N-linked Glycosylation in Bacteria or Rhamnose containing glycans or linker unit-arabinogalactan synthesis (EC 5.1.3.2)

MetaCyc Pathways

• colanic acid building blocks biosynthesis (11/11 steps found)
• D-galacturonate degradation III (2/2 steps found)
• D-glucuronate degradation III (2/2 steps found)
• D-glucuronate degradation II (4/5 steps found)
• UDP-α-D-galactose biosynthesis (1/1 steps found)
• UDP-N-acetyl-D-galactosamine biosynthesis I (1/1 steps found)
• superpathway of UDP-glucose-derived O-antigen building blocks biosynthesis (4/6 steps found)
• UDP-α-D-galactofuranose biosynthesis (1/2 steps found)
• D-galacturonate degradation II (3/5 steps found)
• UDP-N-acetyl-D-galactosamine biosynthesis II (4/7 steps found)
• D-galactose detoxification (1/3 steps found)
• D-galactose degradation I (Leloir pathway) (2/5 steps found)
• stachyose degradation (2/7 steps found)
• UDP-sugars interconversion (3/9 steps found)
• teichuronic acid biosynthesis (B. subtilis 168) (2/9 steps found)
• superpathway of microbial D-galacturonate and D-glucuronate degradation (15/31 steps found)
• superpathway of mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (12/33 steps found)
• mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (1/18 steps found)

KEGG Metabolic Maps

• Galactose metabolism
• Nucleotide sugars metabolism

Isozymes

Compare fitness of predicted isozymes for: 5.1.3.2

Use Curated BLAST to search for 1.1.1.203 or 5.1.3.2

Sequence Analysis Tools

See A0A0C4YG89 at UniProt or InterPro

Protein Sequence (272 amino acids)

>RR42_RS11300 epimerase (Cupriavidus basilensis FW507-4G11)
MTKIALSGAGGQLGTVLRTALLARGYDLRSSGNSQSLAPVAEGEEVMRGDLCDPAVVDRL
LDGVDVLIHMAGTSVERPLPEIIDNNLRALVEVYEGARRQKVGRIVFASSNHAIGMYPVD
QQLSTDCEFRPDGFYGLSKMWGEGLARLYWDKHGIESVCVRIGSCVERPQEFRHLSTWLG
HEDLVHLIEQGITVPDLGFLVVWGVSANARSCWNNDGAARLRYRPKQNAEDFAEEILAGP
NPLDAIGRQYQGGSFASIDFTPEAQRHGGAHR