Protein Info for RR42_RS11260 in Cupriavidus basilensis FW507-4G11

Updated annotation (from data): Methylisocitrate lyase (EC 4.1.3.30)
Rationale: Specifically important for utilizing Sodium propionate. Automated validation from mutant phenotype: the predicted function (4.1.3.30) was linked to the condition via a SEED subsystem. This annotation was also checked manually.
Original annotation: 2-methylisocitrate lyase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 302 TIGR02317: methylisocitrate lyase" amino acids 13 to 297 (285 residues), 430.6 bits, see alignment E=1.2e-133 PF13714: PEP_mutase" amino acids 17 to 260 (244 residues), 151.4 bits, see alignment E=3.4e-48 PF00463: ICL" amino acids 87 to 178 (92 residues), 39.3 bits, see alignment E=3.1e-14

Best Hits

Swiss-Prot: 94% identical to PRPB_CUPNE: 2-methylisocitrate lyase (prpB) from Cupriavidus necator

KEGG orthology group: K03417, methylisocitrate lyase [EC: 4.1.3.30] (inferred from 95% identity to reh:H16_A1905)

MetaCyc: 95% identical to 2-methylcitrate lyase (Cupriavidus necator)
Methylisocitrate lyase. [EC: 4.1.3.30]

Predicted SEED Role

"Methylisocitrate lyase (EC 4.1.3.30)" in subsystem Methylcitrate cycle or Propionate-CoA to Succinate Module (EC 4.1.3.30)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.1.3.30

Use Curated BLAST to search for 4.1.3.30

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4Y9S6 at UniProt or InterPro

Protein Sequence (302 amino acids)

>RR42_RS11260 Methylisocitrate lyase (EC 4.1.3.30) (Cupriavidus basilensis FW507-4G11)
MTFSTSDLARSAGARFRQALADEHPLQVVGTINANHALLAKRAGYRAIYLSGGGVAAGSL
GLPDLGISNLDDVLTDVRRITDVCDVPLLVDVDTGFGASAFNVARTTRSLIKFGAGAMHI
EDQVGAKRCGHRPGKEIVSQGEMADRIKAAVDARTDENFVIMARTDALAVEGLDKAIERA
VACVEAGADAIFPEAMTDLAMYRKFVDAVKVPVLANITEFGATPLFTTEELGGAGVSMVL
YPLSAFRAMNKAAENVYAAIRRDGTQQNVVDTMQTRAELYESIGYHAYEQKLDALFAQGK
AK