Protein Info for RR42_RS11200 in Cupriavidus basilensis FW507-4G11

Annotation: XRE family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 233 PF13560: HTH_31" amino acids 25 to 79 (55 residues), 36 bits, see alignment E=1.4e-12 PF01381: HTH_3" amino acids 29 to 78 (50 residues), 33.3 bits, see alignment E=8.2e-12 PF07883: Cupin_2" amino acids 146 to 200 (55 residues), 55 bits, see alignment E=1.1e-18 PF05899: Cupin_3" amino acids 151 to 185 (35 residues), 33 bits, see alignment 8.1e-12

Best Hits

KEGG orthology group: None (inferred from 82% identity to reh:H16_B1131)

Predicted SEED Role

"Transcriptional regulator, MerR family" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4Y9P5 at UniProt or InterPro

Protein Sequence (233 amino acids)

>RR42_RS11200 XRE family transcriptional regulator (Cupriavidus basilensis FW507-4G11)
MKTHIAPGRGSDDSDESRTLDRETFGKRLRSARKAFGWTLAHLAELSGVSITTISRAERG
QLALGYENFAALGKALRMDMGSMFAGAGAKPAPFQGPVVTRAGEGVTYRGVSFSYEFLGT
EAVGKQMIPVVSTVHARRIAGPEDFARHPGEEFVYVLSGEIEVHFDGGERVRLARGDSLY
FDARMGHAYISLSRQLARIVGVMTSESSFMKSAQAGETEAAPKPAARRPRGKG