Protein Info for RR42_RS11100 in Cupriavidus basilensis FW507-4G11

Annotation: gamma-aminobutyrate permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 509 transmembrane" amino acids 27 to 48 (22 residues), see Phobius details amino acids 55 to 79 (25 residues), see Phobius details amino acids 100 to 126 (27 residues), see Phobius details amino acids 128 to 130 (3 residues), see Phobius details amino acids 133 to 153 (21 residues), see Phobius details amino acids 163 to 187 (25 residues), see Phobius details amino acids 204 to 222 (19 residues), see Phobius details amino acids 251 to 271 (21 residues), see Phobius details amino acids 292 to 316 (25 residues), see Phobius details amino acids 349 to 370 (22 residues), see Phobius details amino acids 376 to 399 (24 residues), see Phobius details amino acids 421 to 440 (20 residues), see Phobius details amino acids 452 to 472 (21 residues), see Phobius details PF00324: AA_permease" amino acids 26 to 479 (454 residues), 446 bits, see alignment E=1.6e-137 PF13520: AA_permease_2" amino acids 27 to 443 (417 residues), 133.8 bits, see alignment E=8.3e-43

Best Hits

Swiss-Prot: 68% identical to LYSP_ECOLI: Lysine-specific permease (lysP) from Escherichia coli (strain K12)

KEGG orthology group: K03293, amino acid transporter, AAT family (inferred from 86% identity to reu:Reut_A1404)

MetaCyc: 68% identical to lysine:H+ symporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-58

Predicted SEED Role

"Lysine-specific permease" in subsystem YeiH

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YBT0 at UniProt or InterPro

Protein Sequence (509 amino acids)

>RR42_RS11100 gamma-aminobutyrate permease (Cupriavidus basilensis FW507-4G11)
MSSHPHPHQHPVVEHDDLQRKLKARHLTMIAIGGAVGTGLFVASGASISQAGPGGALLMY
CLIGLMVYCLMTSLGELAVHMPVAGSFVTYSALYVEEGFGFALGWSYWFSLAVTIAVELA
AAQLVMQYWFPHVSGVVWSAGFLLLMFGLNAFSVRGFGEAEYWFALIKVATILIFLAAGL
MMIFGIMQGGPQSGWHNFTLGDAPFVGGIPAMFGVAMIAGFSFQGTETVGVAAGEAADPA
RTIPRAIRQTFWRILLFYVLAILIIGVLIPYTDPSLLRNDVTDIGVSPFALVFRHAGLAF
AAGLMNAVVLTALLSAGTSSMYASTRILYGLAVSGRAPRALARLSANGVPYVALFATTAV
GALCFLSSLFGDKAVYLWLLNTSGMTGFIAWLGIAISHYRFRRGLVHQGYKPSDLAYRSP
LYPFGPLFAIVLCVVIVLGQNYQAFSDVRGRWLEIVGTYIGVPLFLVLWLGYRLVKKTRL
IDYEDMPFNCKRAAEAGPAAASLPRHSAG