Protein Info for RR42_RS10910 in Cupriavidus basilensis FW507-4G11

Annotation: aminodeoxychorismate lyase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 331 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details TIGR00247: conserved hypothetical protein, YceG family" amino acids 1 to 329 (329 residues), 271.9 bits, see alignment E=3.9e-85 PF02618: YceG" amino acids 40 to 326 (287 residues), 279.2 bits, see alignment E=2.1e-87

Best Hits

KEGG orthology group: K07082, UPF0755 protein (inferred from 84% identity to cti:RALTA_A1494)

Predicted SEED Role

"FIG004453: protein YceG like"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4Y331 at UniProt or InterPro

Protein Sequence (331 amino acids)

>RR42_RS10910 aminodeoxychorismate lyase (Cupriavidus basilensis FW507-4G11)
MKRLFLRLLLVAVIFTIAAAGAFAWWANRPLALTASPIEVVIKPNSSVASVGRQIQRGGV
RMDPRLFALLVRLTGHGADLKAGGYEFDSSATPLSVIGKIARGEVNHYVLTVIEGWEFRK
MRAAVDAHPALKHDSRGLSDVELMKAIGAPEPAPEGLFFPDTYLFARGSSDLELYKHAYR
AMQRRLTDAWNARAPDLPYKSPYEALIMASIVEKETGQPAERPLIAAVFVNRLRKGMMLQ
TDPTVIYGMGEAFEGNIRKRDLQSDTPYNTYTRNGLPPTPIALPGLASLAAATAPAPSDA
LYFVARGDGSSHFSNSLPEHNRAVDKYQRGK