Protein Info for RR42_RS10765 in Cupriavidus basilensis FW507-4G11

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01026: TatD_DNase
  • amino acids 2 to 256 (255 residues), 237.2 bits, E=1e-74

Best Hits

Swiss-Prot: 50% identical to TATD_ERWBE: 3'-5' ssDNA/RNA exonuclease TatD (tatD) from Erwinia billingiae (strain Eb661)

KEGG orthology group: K03424, TatD DNase family protein [EC: 3.1.21.-] (inferred from 50% identity to ebi:EbC_02390)

MetaCyc: 48% identical to 3' -> 5' ssDNA/RNA exonuclease TatD (Escherichia coli K-12 substr. MG1655)
3.1.13.-; Exodeoxyribonuclease I. [EC: 3.1.11.1]

Predicted SEED Role

"Deoxyribonuclease TatD" in subsystem Twin-arginine translocation system or YcfH

Isozymes

Compare fitness of predicted isozymes for: 3.1.21.-

Use Curated BLAST to search for 3.1.11.1 or 3.1.21.-

Sequence Analysis Tools

See A0A0C4Y2Z9 at UniProt or InterPro

Protein Sequence (259 amino acids)

>RR42_RS10765 hypothetical protein (Cupriavidus basilensis FW507-4G11)
MIDIGVNFHSSQIAPHTAVILERAKAAGVVGILATGTSLESSRGARDLASRHPHFLFATA
GIHPHSAKDWSPTVLQSLQALWESPDVVAIGECGLDYNRNFSTPADQRHAFEAQLEAAVR
WNKPLFLHCRDAFDDLYAMVAPAVRAGAHGVVHCFTGAADEAAAFVALGLDIGITGWVTD
IKRGQALREAVQAIPLEHLHLETDAPYLGPKNHKNRRPYNEPANLPWIAQAVAELKGLSM
REVADQCTRNSRRLFGIPA