Protein Info for RR42_RS10545 in Cupriavidus basilensis FW507-4G11

Annotation: NADPH:quinone dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 328 transmembrane" amino acids 123 to 140 (18 residues), see Phobius details amino acids 152 to 172 (21 residues), see Phobius details TIGR02823: putative quinone oxidoreductase, YhdH/YhfP family" amino acids 5 to 326 (322 residues), 427.9 bits, see alignment E=9.7e-133 PF08240: ADH_N" amino acids 29 to 116 (88 residues), 52.9 bits, see alignment E=3.9e-18 PF00107: ADH_zinc_N" amino acids 161 to 282 (122 residues), 45.9 bits, see alignment E=5.7e-16

Best Hits

Swiss-Prot: 56% identical to ACUI_RHOS4: Acrylyl-CoA reductase AcuI (acuI) from Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158)

KEGG orthology group: None (inferred from 80% identity to pba:PSEBR_a3060)

MetaCyc: 53% identical to acryloyl-CoA reductase monomer (Ruegeria pomeroyi DSS-3)
RXN-9087 [EC: 1.3.1.84]

Predicted SEED Role

"Alcohol dehydrogenase (EC 1.1.1.1)" in subsystem Fermentations: Mixed acid or Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 1.1.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.1

Use Curated BLAST to search for 1.1.1.1 or 1.3.1.84

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YFK7 at UniProt or InterPro

Protein Sequence (328 amino acids)

>RR42_RS10545 NADPH:quinone dehydrogenase (Cupriavidus basilensis FW507-4G11)
MTFRALLATKTGDAISTDLVDFDEDHLMPGEVTVAIDYSTVNYKDAMAISGRAPVIRQFP
LIPGIDFAGVVEASTHAGFAVGDRVVANGWGLSQTHHGGFAQKARVSGDWLVKLPDVFST
RDAMAVGTAGYTAMLSVLALEHAGVSPDKGEILVTGAGGGAGSIAIALLSRLGYRVVAST
GRLDEADYLHALGAAEVIDRRTLSEPGAPIGKERWAGAIDSVGSHTLANVLAQTRYRGAV
AAFGLAQGTDLPGSVLPFILRNVTLAGIDSVNAPQDVRLQAWARLATDLDLGKLARATQV
VALADVPGLAGPVLQGQVRGRTVVDVNA