Protein Info for RR42_RS10380 in Cupriavidus basilensis FW507-4G11

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 286 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 38 to 56 (19 residues), see Phobius details amino acids 61 to 82 (22 residues), see Phobius details amino acids 94 to 112 (19 residues), see Phobius details amino acids 134 to 154 (21 residues), see Phobius details amino acids 187 to 211 (25 residues), see Phobius details amino acids 222 to 249 (28 residues), see Phobius details amino acids 259 to 277 (19 residues), see Phobius details PF02653: BPD_transp_2" amino acids 8 to 273 (266 residues), 129.9 bits, see alignment E=5.1e-42

Best Hits

KEGG orthology group: K01997, branched-chain amino acid transport system permease protein (inferred from 73% identity to reu:Reut_C6212)

Predicted SEED Role

"High-affinity branched-chain amino acid transport system permease protein LivH (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4Y959 at UniProt or InterPro

Protein Sequence (286 amino acids)

>RR42_RS10380 ABC transporter permease (Cupriavidus basilensis FW507-4G11)
MSLLLTQTLNGLTFASLLFLMASGFTLIFGLMRVPNMAHGALFMLGAYLAVTLLGADLPF
AVAALLAAVLVGVLGVFVERVILARIAGNELAQVLATLGIAFVIADACRAAWGGMPLEVA
SPEWLSGTTTFAGTVFPLYRLFVVGVAVAIAIALDRSLSRTTLGARLRAAVDDRVMARAV
GIPVDRLFVATFFAGAALVGLAGVIGAPILSVFPGLDMEVLPLVLIVVVLGGTGSIPGAF
LGSVLTGFVYSFGQTLLPELSYVLLFVPMIAVLALRPQGLCGRKPS