Protein Info for RR42_RS09645 in Cupriavidus basilensis FW507-4G11

Annotation: acetyl xylan esterase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 298 PF02129: Peptidase_S15" amino acids 6 to 147 (142 residues), 46.3 bits, see alignment E=2.1e-15 PF01738: DLH" amino acids 11 to 130 (120 residues), 23.6 bits, see alignment E=1.6e-08 PF20434: BD-FAE" amino acids 14 to 122 (109 residues), 32.6 bits, see alignment E=2.8e-11 PF00561: Abhydrolase_1" amino acids 25 to 273 (249 residues), 44.6 bits, see alignment E=6.4e-15 PF12697: Abhydrolase_6" amino acids 27 to 278 (252 residues), 40.6 bits, see alignment E=2.2e-13 PF00326: Peptidase_S9" amino acids 77 to 134 (58 residues), 28.8 bits, see alignment E=4e-10 PF08840: BAAT_C" amino acids 80 to 134 (55 residues), 28.6 bits, see alignment E=6.7e-10 PF05448: AXE1" amino acids 83 to 175 (93 residues), 35.7 bits, see alignment E=1.8e-12

Best Hits

KEGG orthology group: K06889, (no description) (inferred from 82% identity to bpe:BP2856)

Predicted SEED Role

"Hydrolases of the alpha/beta superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YAR1 at UniProt or InterPro

Protein Sequence (298 amino acids)

>RR42_RS09645 acetyl xylan esterase (Cupriavidus basilensis FW507-4G11)
MEFTLDGDVIRGTFYLPAGTTGQVPAVVLAHGWSMVAGGDLEDYAAAVVNEGIAALTFDF
RRLGRSGGQPRQEIDPAWQIEDFRAAISYVRSRPEVDRERIGIWGSSYSGGHALVVAAID
KRVRCVVSQVPTISGFAAAQRRVRYDKARTLQAAFEADREARFAGAAPATLRMIDAEPDA
PVAYPGRDSYDYMHGEAQRCPSWANAVTLRSLELARAYEPGAYIRRIAPTPLLMIVATED
GLTPADLQQEAFNQAHQPKQLLLLGGGHYSVYTEHFDQTSRAAASWFAEHLGKPAHGR