Protein Info for RR42_RS09635 in Cupriavidus basilensis FW507-4G11

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 258 transmembrane" amino acids 47 to 66 (20 residues), see Phobius details amino acids 77 to 97 (21 residues), see Phobius details amino acids 103 to 123 (21 residues), see Phobius details amino acids 142 to 161 (20 residues), see Phobius details amino acids 168 to 189 (22 residues), see Phobius details amino acids 196 to 216 (21 residues), see Phobius details amino acids 228 to 248 (21 residues), see Phobius details PF03988: DUF347" amino acids 23 to 73 (51 residues), 68.2 bits, see alignment 2.8e-23 amino acids 78 to 125 (48 residues), 55.5 bits, see alignment 2.7e-19 amino acids 144 to 193 (50 residues), 58.9 bits, see alignment 2.3e-20 amino acids 198 to 247 (50 residues), 46.8 bits, see alignment 1.4e-16

Best Hits

KEGG orthology group: None (inferred from 83% identity to rme:Rmet_5325)

Predicted SEED Role

"INTEGRAL MEMBRANE PROTEIN (Rhomboid family)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4Y2G7 at UniProt or InterPro

Protein Sequence (258 amino acids)

>RR42_RS09635 membrane protein (Cupriavidus basilensis FW507-4G11)
MTARPTCEASAAAASKVPEVTLAFWLIKIAATTLGETGGDALSMTMGLGYLVSTAIFAAV
FLVVVCAQVRARHFRPLLYWATIVATTTVGTTLADFADRSLGIGYAGGSALLALLLLLSL
ALWYRWLGTVSVDSVHSPRAELCYWVTIMFSQTLGTALGDWTADTAGMGYVGGMAIFGSL
LALLALAYYRTRISRTLLFWAAFILTRPLGAVVGDFLDKPLQSGGLALGRFSASAALLGF
MALCLLLMPQRAAARARH