Protein Info for RR42_RS09460 in Cupriavidus basilensis FW507-4G11

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF08501: Shikimate_dh_N
  • amino acids 22 to 90 (69 residues), 73.4 bits, E=2.9e-24
• PF01488: Shikimate_DH
  • amino acids 112 to 163 (52 residues), 27.2 bits, 7.7e-10
• PF18317: SDH_C
  • amino acids 233 to 264 (32 residues), 33.7 bits, 4.8e-12

Best Hits

Swiss-Prot: 34% identical to AROE_METJA: Shikimate dehydrogenase (NADP(+)) (aroE) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K00014, shikimate dehydrogenase [EC: 1.1.1.25] (inferred from 65% identity to avn:Avin_46700)

MetaCyc: 34% identical to shikimate dehydrogenase monomer (Methanocaldococcus jannaschii)
Shikimate dehydrogenase. [EC: 1.1.1.25]

Predicted SEED Role

No annotation

MetaCyc Pathways

• superpathway of aromatic amino acid biosynthesis (18/18 steps found)
• superpathway of L-tryptophan biosynthesis (13/13 steps found)
• superpathway of L-phenylalanine biosynthesis (10/10 steps found)
• superpathway of L-tyrosine biosynthesis (10/10 steps found)
• superpathway of chorismate metabolism (45/59 steps found)
• chorismate biosynthesis I (7/7 steps found)
• chorismate biosynthesis from 3-dehydroquinate (5/5 steps found)
• chorismate biosynthesis II (archaea) (8/12 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Phenylalanine, tyrosine and tryptophan biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.25

Use Curated BLAST to search for 1.1.1.25

Sequence Analysis Tools

See A0A0C4Y8J1 at UniProt or InterPro

Protein Sequence (271 amino acids)

>RR42_RS09460 hypothetical protein (Cupriavidus basilensis FW507-4G11)
MPRSIPTLCGSIMGEPFTFNVRIHNAAYRALEIDYTFVCFGVQDVPGAVQSIRALGVRGM
NVSMPHKQAVIPHLDHLDETARAIGAVNTINNVDGVLTGYNTDCIGAVRAFQEVTELQGK
RIALLGAGGAARAMAYGLREAGAAVTLFNRTAARGEELAASLGLRFGGALSDFRAADFDL
LANATAAGFRAPDVNPVAGQLAAHLIVMDAAFIPVRSKLIRDAAELGCRTIDGTRMMLHQ
ACAQVEFYTGCARAPIEAMEAALLEEIARQS