Protein Info for RR42_RS09435 in Cupriavidus basilensis FW507-4G11

Annotation: DNA glycosylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03167: UDG
  • amino acids 6 to 145 (140 residues), 72.6 bits, E=1.9e-24

Best Hits

Swiss-Prot: 51% identical to MUG_ENT38: G/U mismatch-specific DNA glycosylase (mug) from Enterobacter sp. (strain 638)

KEGG orthology group: K03649, TDG/mug DNA glycosylase family protein [EC: 3.2.2.-] (inferred from 60% identity to bpy:Bphyt_2122)

MetaCyc: 47% identical to stationary phase mismatch/uracil DNA glycosylase (Escherichia coli K-12 substr. MG1655)
RXN0-1922 [EC: 3.2.2.28]

Predicted SEED Role

"G:T/U mismatch-specific uracil/thymine DNA-glycosylase" in subsystem DNA repair, bacterial

Isozymes

Compare fitness of predicted isozymes for: 3.2.2.-

Use Curated BLAST to search for 3.2.2.- or 3.2.2.28

Sequence Analysis Tools

See A0A0C4YEU4 at UniProt or InterPro

Protein Sequence (169 amino acids)

>RR42_RS09435 DNA glycosylase (Cupriavidus basilensis FW507-4G11)
MISEGLAVVFCGINPGMKAAAGGHHFEGNGNRFWRVLHLAGFTPVLMRPENDRDLLAHRC
GLTTAVARPTARADQLSPHEFHASTSALLKKIELHRPACIAFLGKAAYAAISGQRHVSWG
RQNAMLGGSTVWILPNPSGLNRSFSLDELVVAYRTLYLAYASPKAWFAQ