Protein Info for RR42_RS09405 in Cupriavidus basilensis FW507-4G11

Annotation: butanediol dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 357 transmembrane" amino acids 183 to 189 (7 residues), see Phobius details PF08240: ADH_N" amino acids 26 to 143 (118 residues), 111.3 bits, see alignment E=2.1e-36 PF00107: ADH_zinc_N" amino acids 184 to 310 (127 residues), 118.2 bits, see alignment E=2.4e-38

Best Hits

KEGG orthology group: None (inferred from 89% identity to bcm:Bcenmc03_5781)

Predicted SEED Role

"2,3-butanediol dehydrogenase, R-alcohol forming, (R)- and (S)-acetoin-specific (EC 1.1.1.4)" in subsystem Acetoin, butanediol metabolism (EC 1.1.1.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4Y8L0 at UniProt or InterPro

Protein Sequence (357 amino acids)

>RR42_RS09405 butanediol dehydrogenase (Cupriavidus basilensis FW507-4G11)
MKAAVWRGRHDVRVEEVRVPDKPAEGWVKIRVHWCGICGSDLHEYVAGPVFIPVDHPHPL
TGLKGQCILGHEFSGEIAELGAGVTGFKVGERVTADACQHCGKCYYCTHGLYNICESLAF
TGLMNNGAFAEYVNVPAELLYKLPENFPTEAGALIEPLAVGLHAVKKAGNIVGQTVVVVG
AGTIGLCTIMCAKAAGAGRIIALEMSSARKKKALEVGANVVIDPKECDAIAQVKALTGGY
GADVSFECIGNKATAKLAIDVIRKAGKCVMVGIFEEPSAFNFFEIVSTEKEIIGSLAYNG
EFADVIRFIADGRIDVQPLITGRISLADIVSQGFEELVNNKDGNVKIIVQPVASLAA