Protein Info for RR42_RS09015 in Cupriavidus basilensis FW507-4G11

Annotation: trigger factor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 453 PF05697: Trigger_N" amino acids 1 to 143 (143 residues), 121.2 bits, see alignment E=6.7e-39 TIGR00115: trigger factor" amino acids 12 to 426 (415 residues), 419.5 bits, see alignment E=6.6e-130 PF00254: FKBP_C" amino acids 169 to 250 (82 residues), 59.6 bits, see alignment E=4.8e-20 PF05698: Trigger_C" amino acids 274 to 427 (154 residues), 132.5 bits, see alignment E=2.3e-42

Best Hits

Swiss-Prot: 94% identical to TIG_CUPNH: Trigger factor (tig) from Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337)

KEGG orthology group: K03545, trigger factor (inferred from 94% identity to reh:H16_A1482)

Predicted SEED Role

"Cell division trigger factor (EC 5.2.1.8)" in subsystem Bacterial Cell Division (EC 5.2.1.8)

Isozymes

Compare fitness of predicted isozymes for: 5.2.1.8

Use Curated BLAST to search for 5.2.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4Y280 at UniProt or InterPro

Protein Sequence (453 amino acids)

>RR42_RS09015 trigger factor (Cupriavidus basilensis FW507-4G11)
MSNVIENLGKLDRKVTLAIPKAEVEKEKLERLVRLSKTVKMSGFRPGKVPMKMVEKQYGQ
QVEFEVRFDKAARKFFDITKEQDVKVAGQPKFEVKTDGVGEDEVAFDATFEVYPEVKLGD
LAGAEVTRTKTEITDAEVDKTIDILRKQRVHYHTRGEAGEHGDGGAEVAAQNGDRVTLDF
VGKIDGVEFPGGKADDFAFVLGEGRMLPEFEQAALGLKVGESKTFPLAFPEDYHGKDVAG
KTAEFTVTLKKIEWAHLPEVSDEFAKSLGIADGSVEKMRADIRENLEREVKRRTHAMLKD
QVMDALLKASELEVPKALIEQDQERLVEMARRDLEQRGMPNAKDMPIPAEMFTQQAERRV
KLGLILAEIVKAHGLDAKADQIKAEIEDFAKSYEDPKEVMRWYYGDQQRLAEMEAYVLEN
NVVNFVCDKAKVTDKTVSFEELTAEGNNQPQQA