Protein Info for RR42_RS08990 in Cupriavidus basilensis FW507-4G11

Annotation: DNA polymerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 387 PF00817: IMS" amino acids 11 to 174 (164 residues), 136.9 bits, see alignment E=1e-43 PF11798: IMS_HHH" amino acids 188 to 218 (31 residues), 32.9 bits, see alignment (E = 9.7e-12) PF21704: POLH-Rev1_HhH" amino acids 197 to 250 (54 residues), 29.1 bits, see alignment 1.9e-10 PF11799: IMS_C" amino acids 262 to 369 (108 residues), 99.9 bits, see alignment E=2.3e-32

Best Hits

KEGG orthology group: K02346, DNA polymerase IV [EC: 2.7.7.7] (inferred from 81% identity to bxe:Bxe_B2067)

Predicted SEED Role

"DNA polymerase IV (EC 2.7.7.7)" in subsystem DNA repair, bacterial (EC 2.7.7.7)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.7

Use Curated BLAST to search for 2.7.7.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YEH8 at UniProt or InterPro

Protein Sequence (387 amino acids)

>RR42_RS08990 DNA polymerase (Cupriavidus basilensis FW507-4G11)
MSSAPHRIAHLDMDAFYASVELLRYPELRGKPVVIGGGRNAVPEILPDGSRRFARLRDYA
GRGVVTTSTYEARALGVFSAMGMMKAAQLAPDAILLPTDFDSYRHYSRLFKAAVATFTSD
IEDRGIDEIYIDLSDVPGEPADIGTRIKQAVREATGLSCSICIAPNKLLAKIGSELDKPD
GLTLLAASDVPLRIWPLPVRKVNGIGPKATEKLAALGIATVGDLASADLGMLQTHFGRSY
AAWLAEIAQGHDERPVVTSSEPKSMSRETTFERDLHPKQDRQTLSEVFTGLCQRLAEDLR
RKGYVGRTIGVKLRYDDFHTVTRDLSMPAPTADAAQLRRAATECVKRVALDRKIRLLGVR
VSALTPAGEVAPAALPVQAELPFADNA