Protein Info for RR42_RS08930 in Cupriavidus basilensis FW507-4G11

Annotation: nitrate reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00351: respiratory nitrate reductase, gamma subunit
  • amino acids 5 to 228 (224 residues), 281 bits, E=4.2e-88
• PF02665: Nitrate_red_gam
  • amino acids 6 to 227 (222 residues), 262.5 bits, E=1.5e-82

Best Hits

Swiss-Prot: 57% identical to NARV_ECO57: Respiratory nitrate reductase 2 gamma chain (narV) from Escherichia coli O157:H7

KEGG orthology group: K00374, nitrate reductase 1, gamma subunit [EC: 1.7.99.4] (inferred from 72% identity to adk:Alide2_0468)

MetaCyc: 57% identical to nitrate reductase Z subunit gamma (Escherichia coli K-12 substr. MG1655)
1.97.1.-; RXN0-3501 [EC: 1.7.5.1]

Predicted SEED Role

"Respiratory nitrate reductase gamma chain (EC 1.7.99.4)" in subsystem Nitrate and nitrite ammonification (EC 1.7.99.4)

MetaCyc Pathways

• nitrate reduction IX (dissimilatory) (2/2 steps found)
• NADH to nitrate electron transfer (1/2 steps found)
• nitrate reduction III (dissimilatory) (1/2 steps found)
• nitrate reduction VIII (dissimilatory) (1/2 steps found)
• nitrate reduction VIIIb (dissimilatory) (1/2 steps found)
• nitrate reduction I (denitrification) (3/5 steps found)
• nitrate reduction VII (denitrification) (3/5 steps found)

KEGG Metabolic Maps

• Nitrogen metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.7.99.4

Use Curated BLAST to search for 1.7.5.1 or 1.7.99.4

Sequence Analysis Tools

See A0A0C4YEH1 at UniProt or InterPro

Protein Sequence (247 amino acids)

>RR42_RS08930 nitrate reductase (Cupriavidus basilensis FW507-4G11)
MTAALDTFFFGLYPYICLVVFLVGSLIRFDRDQYTWKSDSSQMLRSGQLRWASNLFHVGV
LFLFFGHLFGMLTPHAVYGHFISAGAKQLLAMISGGMAGVLGFIGVSLLLHRRLGDPRIR
ATSRPGDIAILWLLWVQLALGLGTIPLSGQHLDGSMMLVLAEWAQRIVTLRGGAPALMQG
VGWVFKLHMVLGMTVFLVFPFTRLVHVWSGFASVTYLFRPYQVVRSRRLNLPAGHDRAKR
AQPEQSH