Protein Info for RR42_RS08870 in Cupriavidus basilensis FW507-4G11

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 361 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details transmembrane" amino acids 38 to 57 (20 residues), see Phobius details amino acids 67 to 85 (19 residues), see Phobius details amino acids 91 to 109 (19 residues), see Phobius details amino acids 117 to 137 (21 residues), see Phobius details amino acids 143 to 160 (18 residues), see Phobius details amino acids 173 to 192 (20 residues), see Phobius details amino acids 199 to 221 (23 residues), see Phobius details amino acids 233 to 254 (22 residues), see Phobius details amino acids 265 to 288 (24 residues), see Phobius details amino acids 299 to 317 (19 residues), see Phobius details amino acids 326 to 350 (25 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 83% identity to reh:PHG236)

Predicted SEED Role

"FIG00817499: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YAB5 at UniProt or InterPro

Protein Sequence (361 amino acids)

>RR42_RS08870 hypothetical protein (Cupriavidus basilensis FW507-4G11)
MAVLLLAVCALLAGMLGGWMRAGVMLPWAGDYHVAWRALQFHGALMTGGFFGTVIGIERA
VALGRPVAFAAPVASGLGALLMVAGLPAAGAWAMAAGALVFVGVSVEVLRRQPAAHTALL
LVAAVAWLAGNVGVASGRWLASVNAWYFIFLVVTVAAERLEMTRLMRRRPGAQAALLAIL
AVLVLGAAGSALEGGAGRIGGVIYGAALALLAAWLALFDIARRTVRSHGLSRYMAVCLLL
GYGWLLVAGVAWAATAAGLPWRDAALHALGLGFIVSMVMAHAPVILPAITRIKLQFGNGF
YVPLALLHLSLAARLSFGHALPAIRAAAAAGNVVAILLFIAVAAAAAQAWRSREAPRPRQ
S