Protein Info for RR42_RS08810 in Cupriavidus basilensis FW507-4G11

Annotation: nitrate reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 234 TIGR00684: nitrate reductase molybdenum cofactor assembly chaperone" amino acids 8 to 161 (154 residues), 111 bits, see alignment E=2.8e-36 PF02613: Nitrate_red_del" amino acids 35 to 159 (125 residues), 57.1 bits, see alignment E=1e-19

Best Hits

KEGG orthology group: K00373, nitrate reductase 1, delta subunit [EC: 1.7.99.4] (inferred from 81% identity to reu:Reut_B5004)

Predicted SEED Role

"Respiratory nitrate reductase delta chain (EC 1.7.99.4)" in subsystem Nitrate and nitrite ammonification (EC 1.7.99.4)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.7.99.4

Use Curated BLAST to search for 1.7.99.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4Y252 at UniProt or InterPro

Protein Sequence (234 amino acids)

>RR42_RS08810 nitrate reductase (Cupriavidus basilensis FW507-4G11)
MPLYPILSALLCYPEQELLDALPEIDAALAEWPQAQATLAPLGDLLKTNTLIELQENYVA
TFDRNPAHSLHLFEHVHGESRDRGQAMVDLIEEYRREGFEPAEAELPDYVPLFLEFLGAL
VADGKDAHAGQLLGDAIHVLAAVGDRLARNESPYATAFAVLRTLTDVQPQARTEPPVRDM
DEALETLGPGADGVEPLLAARPTGDQPVHFYARGITPTRTPTRTPTSTPMPTAC