Protein Info for RR42_RS08800 in Cupriavidus basilensis FW507-4G11

Annotation: peptidylprolyl isomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 248 PF13145: Rotamase_2" amino acids 73 to 206 (134 residues), 40.6 bits, see alignment E=6.2e-14 PF13616: Rotamase_3" amino acids 91 to 192 (102 residues), 46.7 bits, see alignment E=6.7e-16 PF00639: Rotamase" amino acids 99 to 191 (93 residues), 63.7 bits, see alignment E=3.9e-21

Best Hits

KEGG orthology group: K03769, peptidyl-prolyl cis-trans isomerase C [EC: 5.2.1.8] (inferred from 70% identity to reh:H16_B2269)

Predicted SEED Role

"Peptidyl-prolyl cis-trans isomerase PpiD (EC 5.2.1.8)" (EC 5.2.1.8)

Isozymes

Compare fitness of predicted isozymes for: 5.2.1.8

Use Curated BLAST to search for 5.2.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4Y865 at UniProt or InterPro

Protein Sequence (248 amino acids)

>RR42_RS08800 peptidylprolyl isomerase (Cupriavidus basilensis FW507-4G11)
MPVLVNGVELEDAEIERELAHHSGSPEPTRHAVVALILRHLVRAQARRLGLPDSDDEALT
QALLEREVGLPEPDEASCRRHYDHHLEHFREGEWVEAEHILFQVTPRVPLDALRATAEAT
LAQVQADPPAFAGLAIARSNCPTGAGGGRLGRVLRGETAPEFERAIFAARHPGVLARLVE
TRYGLHVVRVVARCEGVQLPFDAVRQSIARALAAAARDRAWKQYASLLIGGASIEGIDLG
GAETPLVQ