Protein Info for RR42_RS07735 in Cupriavidus basilensis FW507-4G11

Annotation: histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 451 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details transmembrane" amino acids 152 to 174 (23 residues), see Phobius details PF00512: HisKA" amino acids 229 to 293 (65 residues), 41.1 bits, see alignment E=1.5e-14 PF02518: HATPase_c" amino acids 337 to 427 (91 residues), 54.5 bits, see alignment E=1.5e-18

Best Hits

KEGG orthology group: K02484, two-component system, OmpR family, sensor kinase [EC: 2.7.13.3] (inferred from 92% identity to reu:Reut_B5169)

Predicted SEED Role

"Sensor histidine kinase"

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4Y7G4 at UniProt or InterPro

Protein Sequence (451 amino acids)

>RR42_RS07735 histidine kinase (Cupriavidus basilensis FW507-4G11)
MLRSLQGRLAAALVAGLAVLSLAAAAASFYVLRHEVDRMSDSALQEAAQRLLPLAIMDIV
GRDADGDDDGSRRIAAVRPHDELLTYAVRDDRGRLLLRSHDADTVIFPSDLKAGFTSTAS
HRIYAEPGLQGTISLMIAEPLATRRHAVIEAALAVARVLILFLPVGLCGIWLIVRTGLRP
IRRFCDSIAARGQNDLTPLEREELPTEVAPIADAVNDLMARLDRALAAERSFTANSAHEL
RTPIAAALAQTQRLMAEAPSDRVRERVQNIERGLHALSRVSERLMQLAKAENGRVLGDAP
QDLRPVLELVVEDFRRVASANPIQLDLPDQPVPSWIDQDAFAIVVRNLVENAQKHGSPGQ
TVGISLLATGSLTVRNHGPVLPNDELDRLTKPFERGATAAKGSGLGLAIVEAIVRGAGSS
LELRSPVPGWQDGLQVSIDRLLVAPAMQKRV