Protein Info for RR42_RS07565 in Cupriavidus basilensis FW507-4G11

Annotation: transcription accessory protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 789 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details PF09371: Tex_N" amino acids 16 to 203 (188 residues), 239.9 bits, see alignment E=5e-75 PF16921: Tex_YqgF" amino acids 337 to 463 (127 residues), 182.9 bits, see alignment E=9.5e-58 PF12836: HHH_3" amino acids 503 to 567 (65 residues), 99.7 bits, see alignment E=2.5e-32 PF03934: T2SSK" amino acids 508 to 561 (54 residues), 25.6 bits, see alignment 4e-09 PF17674: HHH_9" amino acids 573 to 642 (70 residues), 82.9 bits, see alignment E=7.1e-27 PF00575: S1" amino acids 661 to 732 (72 residues), 71.3 bits, see alignment E=2.1e-23

Best Hits

Swiss-Prot: 65% identical to TEX_BORPE: Protein tex (tex) from Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)

KEGG orthology group: K06959, uncharacterized protein (inferred from 78% identity to bcn:Bcen_6281)

Predicted SEED Role

"Transcription accessory protein (S1 RNA-binding domain)" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4Y7J5 at UniProt or InterPro

Protein Sequence (789 amino acids)

>RR42_RS07565 transcription accessory protein (Cupriavidus basilensis FW507-4G11)
MSTLPASVMQKIVSLIAAELSVQPRQVAAAVELLDEGATVPFIARYRKEVTGNLDDTHLR
NLEERLLYLREMEERRATILASIEEQGKLTPELRAAVEGAETKQVLEDLYLPYKPKRRTR
AQIARECGLEPLALALLADPTLDPQAEAAKYVNGNPTADGGVPDIKAALDGARDILSEQF
GETAELLGKVREHLWSHGLVTSSVMEGKEGAEEEKFRDYYEYSETIRTIPSHRALALFRG
RNAGVLMVKLGLGEEQDAMVPHPCEGMIARHVGIQNQNRPADKWLADVCRWCWRVKVQPH
LETELLTQLRETAESEAIKVFGRNLHELLLAAPAGPKSVMGIDPGIRTGCKVAVVDATGK
LIDTATIYPHEPRRDWNGSLATLARMAKQHNVMLVSIGNGTASRETDKLVLDLMKALPEA
KLTKIVVSEAGASVYSASELAAKEFPDLDVSIRGAVSIARRLQDPLAELVKIDPKSIGVG
QYQHDVNQRELARALDAVVEDCVNAVGVDVNTASAPLLARVSGLNTVLARNIVEYRDANG
AFPNRAALKKVPRLGDKTFEQAAGFLRVNDGDNPLDRSSVHPEAYPVVKRILDQIKKGLP
EVMGNREALRGLSPTSFTDETFGLPTVRDILSELEKPGRDPRPEFKTATFQDGVEDIKHL
QPGMVLEGVVTNVAAFGAFVDIGVHQDGLVHISALSTKFIKDAHEAVKAGQIVKVKVMEV
DVKRNRIGLTMRLDDEPGQGPVRAGQTDRGNAPRQGQGQRPGQGKGFGGNQRRDEPSGAM
AAAFAKLKR