Protein Info for RR42_RS07320 in Cupriavidus basilensis FW507-4G11

Annotation: MarR family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 149 TIGR02337: homoprotocatechuate degradation operon regulator, HpaR" amino acids 10 to 138 (129 residues), 168.3 bits, see alignment E=3.4e-54 PF12802: MarR_2" amino acids 33 to 92 (60 residues), 43.7 bits, see alignment E=3.7e-15 PF01047: MarR" amino acids 35 to 91 (57 residues), 52.4 bits, see alignment E=5.9e-18 PF13463: HTH_27" amino acids 35 to 100 (66 residues), 22.4 bits, see alignment E=1.8e-08

Best Hits

Swiss-Prot: 41% identical to FARR_NEIGO: HTH-type transcriptional regulator FarR (farR) from Neisseria gonorrhoeae

KEGG orthology group: None (inferred from 62% identity to rsc:RCFBP_11599)

Predicted SEED Role

"Homoprotocatechuate degradative operon repressor" in subsystem 4-Hydroxyphenylacetic acid catabolic pathway or Aromatic amino acid degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4Y9E9 at UniProt or InterPro

Protein Sequence (149 amino acids)

>RR42_RS07320 MarR family transcriptional regulator (Cupriavidus basilensis FW507-4G11)
MKPATFRHRNLPHLLLQARETLMAGFRPILRQHGMTEQQWRVVRTLNEQGEMEPNQLADA
CLILSPSLTRMLSSMEEAGLILRSRSTTDQRRQLISLTDKCRALIAEMEPLIDRRYAQLE
QMIGAERLGKVYGAIDELLVSLSERDPRA