Protein Info for RR42_RS06620 in Cupriavidus basilensis FW507-4G11

Annotation: phenylalanyl-tRNA synthetase subunit alpha

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 343 PF02912: Phe_tRNA-synt_N" amino acids 21 to 88 (68 residues), 69.5 bits, see alignment E=1.9e-23 TIGR00468: phenylalanine--tRNA ligase, alpha subunit" amino acids 39 to 342 (304 residues), 324.4 bits, see alignment E=4.1e-101 PF01409: tRNA-synt_2d" amino acids 93 to 342 (250 residues), 315.2 bits, see alignment E=3.1e-98

Best Hits

Swiss-Prot: 96% identical to SYFA_CUPTR: Phenylalanine--tRNA ligase alpha subunit (pheS) from Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CIP 107171 / LMG 19424 / R1)

KEGG orthology group: K01889, phenylalanyl-tRNA synthetase alpha chain [EC: 6.1.1.20] (inferred from 95% identity to reu:Reut_A1279)

Predicted SEED Role

"Phenylalanyl-tRNA synthetase alpha chain (EC 6.1.1.20)" (EC 6.1.1.20)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.1.1.20

Use Curated BLAST to search for 6.1.1.20

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4Y978 at UniProt or InterPro

Protein Sequence (343 amino acids)

>RR42_RS06620 phenylalanyl-tRNA synthetase subunit alpha (Cupriavidus basilensis FW507-4G11)
MSLDPDQIVADAQAAFAAANDNATLENEKARFLGKTGALTELLKSLGKLDPETRKSEGAR
INQAKQQVEAALQARRQALADALMNARLAAEAIDVTLPGRAVARGSLHPVMRTWERVEQI
FGSVGFDVADGPEIETDWMNFTALNNPDNHPARSMQDTFYVDGRDSDGKLLLLRTHTSPM
QVRYARMHVEKYKGREMPPIKVICPGRTYRVDSDATHSPMFNQVEGLWIGDDVSFADLKG
VYTDFLRKFFERDDIQVRFRPSYFPFTEPSAEIDMAFGNGKWLEISGSGQVHPNVLRNMG
LDPERYIGFAFGSGLERLTMLRYGINDLRLFFEGDARFLRQFA