Protein Info for RR42_RS06550 in Cupriavidus basilensis FW507-4G11

Annotation: LuxR family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 181 TIGR00229: PAS domain S-box protein" amino acids 6 to 118 (113 residues), 34 bits, see alignment E=1.4e-12 PF13426: PAS_9" amino acids 14 to 116 (103 residues), 43 bits, see alignment E=6.8e-15 PF00196: GerE" amino acids 124 to 176 (53 residues), 52.5 bits, see alignment E=4.5e-18

Best Hits

KEGG orthology group: None (inferred from 91% identity to rme:Rmet_1152)

Predicted SEED Role

"Response regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4Y175 at UniProt or InterPro

Protein Sequence (181 amino acids)

>RR42_RS06550 LuxR family transcriptional regulator (Cupriavidus basilensis FW507-4G11)
MPAIDYQTAFQLAPVGLVLSRERMIEDCNDELCRIFGTTRAAMIGESFQVLYPTADEFER
TGARIVPIMNAKGTYSDERIMKRAGGDLFWCHVTGRSLDRQQPLGAGIWTFEDLSQKRPV
TAELTARERDIAAQLVDGKTSKQIGKLLSISPRTVDIYRARLMKKYSAHTSVDLVQRLLN
H