Protein Info for RR42_RS06545 in Cupriavidus basilensis FW507-4G11

Annotation: thioesterase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 132 PF20791: Acyl-ACP_TE_C" amino acids 7 to 32 (26 residues), 21.8 bits, see alignment 2.7e-08 PF13279: 4HBT_2" amino acids 11 to 129 (119 residues), 80.8 bits, see alignment E=1.8e-26 PF03061: 4HBT" amino acids 19 to 99 (81 residues), 51.3 bits, see alignment E=1.8e-17

Best Hits

KEGG orthology group: K07107, acyl-CoA thioester hydrolase [EC: 3.1.2.-] (inferred from 83% identity to reh:H16_A1329)

Predicted SEED Role

"4-hydroxybenzoyl-CoA thioesterase (EC 3.1.2.23)" (EC 3.1.2.23)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.2.-, 3.1.2.23

Use Curated BLAST to search for 3.1.2.- or 3.1.2.23

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YDF1 at UniProt or InterPro

Protein Sequence (132 amino acids)

>RR42_RS06545 thioesterase (Cupriavidus basilensis FW507-4G11)
MKPVFTLHMPIRWGDMDAMGHVNNTVYFRYLEQARIAWFESLGHGGKDASGCGPVIINAH
MSFLKQLRYPGDIECRMFAGDLGRTSFETRMEIRRIDQPDVVYAQGGAKVVWCDYEAEKS
VPVPPAIRALME