Protein Info for RR42_RS06545 in Cupriavidus basilensis FW507-4G11

Annotation: thioesterase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF20791: Acyl-ACP_TE_C
  • amino acids 7 to 32 (26 residues), 21.8 bits, 2.7e-08
• PF13279: 4HBT_2
  • amino acids 11 to 129 (119 residues), 80.8 bits, E=1.8e-26
• PF03061: 4HBT
  • amino acids 19 to 99 (81 residues), 51.3 bits, E=1.8e-17

Best Hits

KEGG orthology group: K07107, acyl-CoA thioester hydrolase [EC: 3.1.2.-] (inferred from 83% identity to reh:H16_A1329)

Predicted SEED Role

"4-hydroxybenzoyl-CoA thioesterase (EC 3.1.2.23)" (EC 3.1.2.23)

MetaCyc Pathways

• 4-hydroxybenzoate biosynthesis III (plants) (4/5 steps found)
• 4-chlorobenzoate degradation (2/4 steps found)

KEGG Metabolic Maps

• 2,4-Dichlorobenzoate degradation
• Benzoate degradation via CoA ligation
• Biosynthesis of plant hormones
• Biosynthesis of unsaturated fatty acids
• Fatty acid biosynthesis
• Limonene and pinene degradation
• Ubiquinone and menaquinone biosynthesis
• alpha-Linolenic acid metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.1.2.-, 3.1.2.23

Use Curated BLAST to search for 3.1.2.- or 3.1.2.23

Sequence Analysis Tools

See A0A0C4YDF1 at UniProt or InterPro

Protein Sequence (132 amino acids)

>RR42_RS06545 thioesterase (Cupriavidus basilensis FW507-4G11)
MKPVFTLHMPIRWGDMDAMGHVNNTVYFRYLEQARIAWFESLGHGGKDASGCGPVIINAH
MSFLKQLRYPGDIECRMFAGDLGRTSFETRMEIRRIDQPDVVYAQGGAKVVWCDYEAEKS
VPVPPAIRALME