Protein Info for RR42_RS06535 in Cupriavidus basilensis FW507-4G11

Annotation: C4-dicarboxylate ABC transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 342 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details PF03480: DctP" amino acids 38 to 325 (288 residues), 247.4 bits, see alignment E=9.5e-78 TIGR00787: TRAP transporter solute receptor, DctP family" amino acids 44 to 279 (236 residues), 201.4 bits, see alignment E=8.9e-64

Best Hits

KEGG orthology group: None (inferred from 93% identity to reu:Reut_A1266)

Predicted SEED Role

"TRAP-type C4-dicarboxylate transport system, periplasmic component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4Y967 at UniProt or InterPro

Protein Sequence (342 amino acids)

>RR42_RS06535 C4-dicarboxylate ABC transporter (Cupriavidus basilensis FW507-4G11)
MKRRALMLSLAATIAAAALAPAGAMAQSYKAEYKMSLVLGPAFPWGKGGEIWADLVRQRT
SGRINIKLYPGTSLVAGDQTREFSAIRQGVIDMAVGSTINWSPQVKELNLFSLPFLMPDY
KALDALTQGEVGKSIFATLDKSGVVPLAWGENGFREVSNSKREIRKPEDLKGMKLRVVGS
PLYIETFNALGANPTQMSWADAQPAMASGAVDGQENPQSVFAAAKLYTVGQKYVTTWGYV
ADPLIFVVNKQIWESWTPADREIVKQAAIDAGKQETALARKGLVEAGAPAWKDMEAHGVK
VAQLTPAEHDAFRKATAKVYDKWKKQIGVDLVSKAEASIAKR