Protein Info for RR42_RS06530 in Cupriavidus basilensis FW507-4G11

Annotation: C4-dicarboxylate ABC transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 434 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details transmembrane" amino acids 53 to 75 (23 residues), see Phobius details amino acids 86 to 111 (26 residues), see Phobius details amino acids 117 to 136 (20 residues), see Phobius details amino acids 144 to 168 (25 residues), see Phobius details amino acids 176 to 200 (25 residues), see Phobius details amino acids 223 to 242 (20 residues), see Phobius details amino acids 248 to 267 (20 residues), see Phobius details amino acids 283 to 305 (23 residues), see Phobius details amino acids 312 to 334 (23 residues), see Phobius details amino acids 337 to 358 (22 residues), see Phobius details amino acids 364 to 388 (25 residues), see Phobius details amino acids 401 to 425 (25 residues), see Phobius details PF06808: DctM" amino acids 9 to 423 (415 residues), 322.5 bits, see alignment E=2e-100 TIGR00786: TRAP transporter, DctM subunit" amino acids 19 to 429 (411 residues), 335.7 bits, see alignment E=1.7e-104

Best Hits

KEGG orthology group: None (inferred from 97% identity to rme:Rmet_1149)

Predicted SEED Role

"TRAP-type C4-dicarboxylate transport system, large permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4Y760 at UniProt or InterPro

Protein Sequence (434 amino acids)

>RR42_RS06530 C4-dicarboxylate ABC transporter (Cupriavidus basilensis FW507-4G11)
MTLIAIILFVVFLGLMMLGVPIGVSLGLGGLVAIGLSNLDTQMFGLLAVPQNFYAGLGKY
PLLAIPMFVLVGSIFDRSGVAQRLVTFAIAIVGRGPGMLPLVAILVAMFLGGISGSGPAN
AAAVGGVMIAAMSRAGYPGAYSAAVVGAAAATDILIPPSVAFIIYSVLVPGASVPALFAA
GMIPGILAGVALIVPAVWLARKHNMGAIEAGLPRPPFWKSLREAAWGLVAPFLILGGMRA
GWFTPTEAAVVAVVYGLFVGMVIYRSISMRDLFVIFQEAAETSAVILLVVALAGIFAYAL
STLGVIDPLANAIAHSGLGEYGVLALIVALLMTVGMFLDGISIFLIFVPLLLPIANAFHW
NPVWFGVVLTLKVALGQFTPPLAVNLMVSCRIARVRMEETVPWVVWMLLAMFVAMLLVLA
FPPLATWLPDYLGY