Protein Info for RR42_RS06365 in Cupriavidus basilensis FW507-4G11

Annotation: tRNA(Ile)-lysidine synthetase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 427 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF01171: ATP_bind_3" amino acids 2 to 183 (182 residues), 184.6 bits, see alignment E=2.4e-58 TIGR02432: tRNA(Ile)-lysidine synthetase" amino acids 2 to 184 (183 residues), 172.1 bits, see alignment E=1.2e-54 PF09179: TilS" amino acids 237 to 302 (66 residues), 54.2 bits, see alignment E=2.1e-18 TIGR02433: tRNA(Ile)-lysidine synthetase, C-terminal domain" amino acids 354 to 400 (47 residues), 43.3 bits, see alignment 1.9e-15 PF11734: TilS_C" amino acids 354 to 427 (74 residues), 76.6 bits, see alignment E=1.2e-25

Best Hits

KEGG orthology group: K04075, tRNA(Ile)-lysidine synthase [EC: 6.3.4.-] (inferred from 72% identity to reh:H16_A1224)

Predicted SEED Role

"tRNA(Ile)-lysidine synthetase (EC 6.3.4.19)" (EC 6.3.4.19)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.3.4.19

Use Curated BLAST to search for 6.3.4.- or 6.3.4.19

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4Y6S8 at UniProt or InterPro

Protein Sequence (427 amino acids)

>RR42_RS06365 tRNA(Ile)-lysidine synthetase (Cupriavidus basilensis FW507-4G11)
MALSGGRDSVALLHALRAAVVASSLPLRVVALHVHHGLQAEADKWDVFCATLCADWQLPF
YSQRVSVSQGRGEGLEAAARRARYAALEAMCDEAGAELLLFAHHLDDQVETVLLRLFRGA
GLAGLGGMPSLRRLGARQQIVLLRPWLDVGRDDIDAYCAVNALPWIDDPSNDDSRFARNA
LRQHMPALAAAFPALRANVAQAAAHLAQAGELLDALATQWMAGLVRTPRDASTLAELDLA
GLRALPPAEADAVLRLWLRELGTQAPSTARLSAMRAQLIEHEGGEPAIQHETLMLHRFRG
RVLARRAGPAIESEDLALHWQGEARLAVPAWHGELRFTRDDTFGLPEAMLHRPLRLAARQ
GGERIVLRPGGPARALKQAYQEAGVPMARRARLPLLWSGDQLVFAAGLGMHRRWPDAPAA
PRWRVEW