Protein Info for RR42_RS06330 in Cupriavidus basilensis FW507-4G11

Annotation: UDP-2,3-diacylglucosamine hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00149: Metallophos
  • amino acids 19 to 220 (202 residues), 43.4 bits, E=5.4e-15
• TIGR01854: UDP-2,3-diacylglucosamine diphosphatase
  • amino acids 20 to 240 (221 residues), 253.9 bits, E=5.7e-80
• PF12850: Metallophos_2
  • amino acids 21 to 143 (123 residues), 29.7 bits, E=6.2e-11

Best Hits

Swiss-Prot: 46% identical to LPXH_PSE14: UDP-2,3-diacylglucosamine hydrolase (lpxH) from Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)

KEGG orthology group: K03269, UDP-2,3-diacylglucosamine hydrolase [EC: 3.6.1.-] (inferred from 78% identity to reu:Reut_A1118)

Predicted SEED Role

"UDP-2,3-diacylglucosamine diphosphatase (EC 3.6.1.54)" (EC 3.6.1.54)

MetaCyc Pathways

• lipid IV_A biosynthesis (P. gingivalis) (9/9 steps found)
• lipid IV_A biosynthesis (E. coli) (6/6 steps found)
• lipid IV_A biosynthesis (H. pylori) (6/6 steps found)
• lipid IV_A biosynthesis (P. putida) (6/6 steps found)
• lipid IV_A biosynthesis (Vibrio cholerae serogroup O1 El Tor) (6/6 steps found)
• lipid IV_A biosynthesis (generic) (6/6 steps found)
• superpathway of (Kdo)₂-lipid A biosynthesis (13/17 steps found)
• lipid IV_A biosynthesis (2,3-diamino-2,3-dideoxy-D-glucopyranose-containing) (5/6 steps found)
• superpathway of Kdo₂-lipid A biosynthesis (13/25 steps found)

KEGG Metabolic Maps

• Folate biosynthesis
• Lipopolysaccharide biosynthesis
• Purine metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.-, 3.6.1.54

Use Curated BLAST to search for 3.6.1.- or 3.6.1.54

Sequence Analysis Tools

See A0A0C4Y733 at UniProt or InterPro

Protein Sequence (262 amino acids)

>RR42_RS06330 UDP-2,3-diacylglucosamine hydrolase (Cupriavidus basilensis FW507-4G11)
MTVTPSTPAAGALAVPAPAWFISDLHLTPGMPRTLASFEHVLERAAQEARALFILGDFFE
FWVGDEETDSPFAAQVAARLRQLAERGVQVYLMHGNRDFLLGQRFARAAGATLLPDPTVI
DCAGQRVVLSHGDMLCTDDERYMRFRHWTRKRWVQRVFLSLPLTLRLRVARRLRADSEAG
RTQARRDAPPDYGDTTPQAVAALLRASQAPALVHGHTHRPARHESPEGVRWVLTDWDLDG
KRPRAAVLQLDAGGFSVLPQVS