Protein Info for RR42_RS06325 in Cupriavidus basilensis FW507-4G11

Annotation: serine O-acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

KEGG orthology group: K00640, serine O-acetyltransferase [EC: 2.3.1.30] (inferred from 91% identity to reh:H16_A1216)

Predicted SEED Role

"Serine acetyltransferase (EC 2.3.1.30)" in subsystem Conserved gene cluster possibly involved in RNA metabolism or Cysteine Biosynthesis or Methionine Biosynthesis (EC 2.3.1.30)

MetaCyc Pathways

superpathway of sulfate assimilation and cysteine biosynthesis (9/9 steps found)
L-cysteine biosynthesis I (2/2 steps found)
L-cysteine biosynthesis VII (from S-sulfo-L-cysteine) (3/4 steps found)
seleno-amino acid biosynthesis (plants) (3/5 steps found)
N-3-oxalyl-L-2,3-diaminopropanoate biosynthesis (1/4 steps found)
L-cysteine biosynthesis VI (reverse transsulfuration) (3/7 steps found)
D-cycloserine biosynthesis (1/6 steps found)
superpathway of seleno-compound metabolism (6/19 steps found)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.30

Use Curated BLAST to search for 2.3.1.30

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4Y149 at UniProt or InterPro

Protein Sequence (247 amino acids)

>RR42_RS06325 serine O-acetyltransferase (Cupriavidus basilensis FW507-4G11)
MFTRLKEDIDAIMRRDPAARSRLEVLTCYPGFHAVVFHRFAHACWNAGFHWLGRWISHWA
RFFTGIEIHPGAKVGRRVFIDHGMGVVVGETAEIGDDCTIYQGVTLGGTSLYKGVKRHPT
LGANVVVSAGAKVLGGYTIGDGARIGSNAVVLKPVPPGATAVGIPARIILPDAPSGQQGA
KQEFSAYGITPNADDPVSLALKSLIDNAAQQHERLETVMAALDRLGEHLENTPNDRFDAS
ELRKLMK