Protein Info for RR42_RS06175 in Cupriavidus basilensis FW507-4G11
Annotation: enolase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 96% identical to ENO1_CUPMC: Enolase 1 (eno1) from Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
KEGG orthology group: K01689, enolase [EC: 4.2.1.11] (inferred from 94% identity to reh:H16_A1188)MetaCyc: 65% identical to enolase (Escherichia coli K-12 substr. MG1655)
Phosphopyruvate hydratase. [EC: 4.2.1.11]
Predicted SEED Role
"Enolase (EC 4.2.1.11)" in subsystem Entner-Doudoroff Pathway or Glycolysis and Gluconeogenesis or Glycolysis and Gluconeogenesis, including Archaeal enzymes or Serine-glyoxylate cycle (EC 4.2.1.11)
MetaCyc Pathways
- superpathway of aromatic amino acid biosynthesis (18/18 steps found)
- superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (23/26 steps found)
- superpathway of L-tryptophan biosynthesis (13/13 steps found)
- superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (19/22 steps found)
- superpathway of L-phenylalanine biosynthesis (10/10 steps found)
- superpathway of L-tyrosine biosynthesis (10/10 steps found)
- superpathway of glycolysis and the Entner-Doudoroff pathway (15/17 steps found)
- superpathway of chorismate metabolism (45/59 steps found)
- Entner-Doudoroff pathway I (9/9 steps found)
- gluconeogenesis III (11/12 steps found)
- homolactic fermentation (11/12 steps found)
- superpathway of anaerobic sucrose degradation (16/19 steps found)
- Bifidobacterium shunt (13/15 steps found)
- glycolysis II (from fructose 6-phosphate) (10/11 steps found)
- glycolysis III (from glucose) (10/11 steps found)
- heterolactic fermentation (15/18 steps found)
- chorismate biosynthesis I (7/7 steps found)
- superpathway of glucose and xylose degradation (14/17 steps found)
- gluconeogenesis I (11/13 steps found)
- glycolysis I (from glucose 6-phosphate) (11/13 steps found)
- chorismate biosynthesis from 3-dehydroquinate (5/5 steps found)
- hexitol fermentation to lactate, formate, ethanol and acetate (15/19 steps found)
- Rubisco shunt (8/10 steps found)
- formaldehyde assimilation I (serine pathway) (10/13 steps found)
- glycolysis VI (from fructose) (8/11 steps found)
- superpathway of aromatic compound degradation via 3-oxoadipate (25/35 steps found)
- gallate biosynthesis (2/3 steps found)
- glycolysis IV (7/10 steps found)
- glycolysis V (Pyrococcus) (7/10 steps found)
- Entner-Doudoroff pathway III (semi-phosphorylative) (6/9 steps found)
- chorismate biosynthesis II (archaea) (8/12 steps found)
- ethene biosynthesis V (engineered) (17/25 steps found)
- quinate degradation I (1/3 steps found)
- quinate degradation II (1/3 steps found)
- 1-butanol autotrophic biosynthesis (engineered) (18/27 steps found)
- photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (17/26 steps found)
- superpathway of N-acetylneuraminate degradation (14/22 steps found)
- superpathway of hexitol degradation (bacteria) (11/18 steps found)
- Entner-Doudoroff pathway II (non-phosphorylative) (4/9 steps found)
- glycerol degradation to butanol (9/16 steps found)
- gluconeogenesis II (Methanobacterium thermoautotrophicum) (9/18 steps found)
- superpathway of aromatic compound degradation via 2-hydroxypentadienoate (21/42 steps found)
- Methanobacterium thermoautotrophicum biosynthetic metabolism (21/56 steps found)
KEGG Metabolic Maps
- Biosynthesis of alkaloids derived from histidine and purine
- Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
- Biosynthesis of alkaloids derived from shikimate pathway
- Biosynthesis of alkaloids derived from terpenoid and polyketide
- Biosynthesis of phenylpropanoids
- Biosynthesis of plant hormones
- Biosynthesis of terpenoids and steroids
- Glycolysis / Gluconeogenesis
Isozymes
Compare fitness of predicted isozymes for: 4.2.1.11
Use Curated BLAST to search for 4.2.1.11
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A0C4YDA2 at UniProt or InterPro
Protein Sequence (429 amino acids)
>RR42_RS06175 enolase (Cupriavidus basilensis FW507-4G11) MSAIVDIIGREVLDSRGNPTVECDVLLESGVMGRAAVPSGASTGSREAIELRDGDKSRYL GKGVLKAVEHINTEISEAIMGLDASEQAFLDRTLIDLDGTDNKARLGANATLAVSMAVAR AAAEEAGLPLYRYFGGSGAMQMPVPMMNIVNGGAHANNSLDIQEFMIMPVSQTSFREALR CGAEVFHALKKILSDKGMSTAVGDEGGFAPNFASNEECLNTILLAIEKAGYRAGEDVLLA LDCAATEFYHEAEGQYHLDGEGLKLTSTQFADYLANLCDKFPIVSIEDGMGEGDWDGWKV LTDKLGKRVQLVGDDLFVTNTKILKEGIEKGIGNSILIKINQIGTLTETFAAIEMAKRAG YTAVISHRSGETEDSTIADIAVGTNAGQIKTGSLSRSDRISKYNQLLRIEEDLGDIASYP GKSAFYNLR