Protein Info for RR42_RS06070 in Cupriavidus basilensis FW507-4G11

Annotation: lysyl-tRNA synthetase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 512 TIGR00499: lysine--tRNA ligase" amino acids 20 to 510 (491 residues), 660.2 bits, see alignment E=9.4e-203 PF01336: tRNA_anti-codon" amino acids 72 to 149 (78 residues), 61.3 bits, see alignment E=7.1e-21 PF00152: tRNA-synt_2" amino acids 165 to 508 (344 residues), 323 bits, see alignment E=2e-100

Best Hits

Swiss-Prot: 89% identical to SYK_CUPTR: Lysine--tRNA ligase (lysS) from Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CIP 107171 / LMG 19424 / R1)

KEGG orthology group: K04567, lysyl-tRNA synthetase, class II [EC: 6.1.1.6] (inferred from 89% identity to cti:RALTA_A1147)

Predicted SEED Role

"Lysyl-tRNA synthetase (class II) (EC 6.1.1.6)" (EC 6.1.1.6)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.1.1.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YD88 at UniProt or InterPro

Protein Sequence (512 amino acids)

>RR42_RS06070 lysyl-tRNA synthetase (Cupriavidus basilensis FW507-4G11)
MTESNRAPAETNVPAAADENKIIAERREKLQALRQQGPAFPNDFRPTHQAAALHTQYSET
EQAVLEATPVEVAIAGRMMLKRVMGKASFATVQDGSGRIQFYISRDAIGEDVYAAFKKWD
LGDIVAARGTLMKTKTGELSVAVTELRLLSKSLRPLPGDYYGLADQEQKYRQRYVDLIVS
PETRATFRARTNAISSLRRHMASNDFMEVETPMLHPIPGGATAKPFITHHNALDMQMFLR
IAPELYLKRLVVGGFERVFEINRNFRNEGVSPRHNPEFTMMEFYAAYTDYRWLMDFTEDL
IRQAAIDARGSAVLTYQDRELDLSKPFHRLTITQAIQKFAPQYTDAQLADTEFLRAELKK
FGINTGAPQFLNAGLGTLQLVLFEETAESQLWEPTFIIDYPVEVSPLARASDTQPGITER
FELFITGREIANGFSELNDAEDQAERFRKQVDQKDAGDEEAMYFDADYIRALEYGMPPTG
GCGIGIDRLVMLLTDSPNIRDVILFPHLRRED