Protein Info for RR42_RS06045 in Cupriavidus basilensis FW507-4G11

Annotation: co-chaperone HscB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 172 TIGR00714: Fe-S protein assembly co-chaperone HscB" amino acids 15 to 169 (155 residues), 104.6 bits, see alignment E=2.8e-34 PF07743: HSCB_C" amino acids 89 to 162 (74 residues), 68.4 bits, see alignment E=2.9e-23

Best Hits

Swiss-Prot: 87% identical to HSCB_CUPTR: Co-chaperone protein HscB homolog (hscB) from Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CIP 107171 / LMG 19424 / R1)

KEGG orthology group: K04082, molecular chaperone HscB (inferred from 87% identity to cti:RALTA_A1143)

Predicted SEED Role

"Chaperone protein HscB" in subsystem Protein chaperones

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4Y6M8 at UniProt or InterPro

Protein Sequence (172 amino acids)

>RR42_RS06045 co-chaperone HscB (Cupriavidus basilensis FW507-4G11)
MKDDYFALFGLPVGYAVDEAALDAAYLTVQSQAHPDRFANAGDAERRVAMQWAAHANEAY
RTLRQPLKRAIYLLTLRGVDIQAESNTAMAPAFLMQQMEWREALQEAVEDNDVARLDALL
RALRGEKRERHAALGALLDAGDNAGAGSAARQLMFIEKIEHDTSEAIDRLEG