Protein Info for RR42_RS05920 in Cupriavidus basilensis FW507-4G11

Annotation: HrcA family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 345 TIGR00331: heat-inducible transcription repressor HrcA" amino acids 2 to 341 (340 residues), 318.7 bits, see alignment E=3.1e-99 PF03444: HrcA_DNA-bdg" amino acids 5 to 72 (68 residues), 23.5 bits, see alignment E=3.5e-09 PF01628: HrcA" amino acids 109 to 328 (220 residues), 220 bits, see alignment E=3.9e-69

Best Hits

KEGG orthology group: K03705, heat-inducible transcriptional repressor (inferred from 88% identity to reu:Reut_A1036)

Predicted SEED Role

"Heat-inducible transcription repressor HrcA" in subsystem Heat shock dnaK gene cluster extended

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4Y8W8 at UniProt or InterPro

Protein Sequence (345 amino acids)

>RR42_RS05920 HrcA family transcriptional regulator (Cupriavidus basilensis FW507-4G11)
MDERAKTLLKTLIERYIAEGQPVGSRTLSKYSGLDLSPATIRNVMSDLEEMGFIASPHTS
AGRIPTPRGYRLFVDTMLTAQPLDGALNLAELTGKIRGQLHGQQLGPQRMITSAAHTLSN
LSQFAGVVMTPRRAQAFRQVEFMRLSDKRILLIIVTPEGDVQNRIIQTELPYSPSQLVEA
ANFINSHFAGMSFDNVRDHLRGELQALRMDMSQLMQAAVEAGSNAMAEGEDDHVFISGER
KLLEVEDLSSSMEKLRRLFDVFEHKTGLLKLLDVSSHAQGVQIFIGGESKLVPLEDMAVI
TAPYEVDGQIVGTLGVIGPTRMAYERVIPIVDITARLLSSALSQN