Protein Info for RR42_RS05880 in Cupriavidus basilensis FW507-4G11

Annotation: acyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00795: CN_hydrolase
  • amino acids 20 to 275 (256 residues), 199.8 bits, E=2.7e-63

Best Hits

KEGG orthology group: K01501, nitrilase [EC: 3.5.5.1] (inferred from 87% identity to reu:Reut_A1028)

Predicted SEED Role

"FIG003879: Predicted amidohydrolase"

MetaCyc Pathways

• indole-3-acetate biosynthesis V (bacteria and fungi) (1/1 steps found)
• indole glucosinolate activation (herbivore attack) (8/13 steps found)
• indole-3-acetate biosynthesis II (6/12 steps found)

KEGG Metabolic Maps

• Benzoate degradation via CoA ligation
• Cyanoamino acid metabolism
• Nitrogen metabolism
• Styrene degradation
• Tryptophan metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.5.1

Sequence Analysis Tools

See A0A0C4YD45 at UniProt or InterPro

Protein Sequence (285 amino acids)

>RR42_RS05880 acyltransferase (Cupriavidus basilensis FW507-4G11)
MTANASASTPSAAHGAPPFRVAAIQTVSGVSPEANVARADALIAQAAKGGAELVLLPEYF
CMMGLREGDKVAIRERDGDGPIQSFLADAARRHRIWLVGGTLPLWCEDEARVYNTSLAYD
PRGERVARYDKIHLFGFTRGSESYDESRTILAGQTPVSFEAPCGRVAMSVCYDLRFPELY
RQLAAGGSTSLILMPAAFTYTTGQAHWEILLRARAIENQCYVLAAAQGGKHENGRRTWGH
SMLIDPWGEVMAVLPEGEGVVSGLIDPARLDEVRQNLPALRHRVL