Protein Info for RR42_RS05780 in Cupriavidus basilensis FW507-4G11

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 261 PF03883: H2O2_YaaD" amino acids 1 to 246 (246 residues), 293.7 bits, see alignment E=4.9e-92

Best Hits

Swiss-Prot: 88% identical to Y1014_CUPNJ: UPF0246 protein Reut_A1014 (Reut_A1014) from Cupriavidus necator (strain JMP 134 / LMG 1197)

KEGG orthology group: K09861, hypothetical protein (inferred from 89% identity to reh:H16_A1106)

Predicted SEED Role

"UPF0246 protein YaaA" in subsystem YaaA

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YD22 at UniProt or InterPro

Protein Sequence (261 amino acids)

>RR42_RS05780 hypothetical protein (Cupriavidus basilensis FW507-4G11)
MLIVLSPAKSLDYETPSRLKTHTLPRFIDRSAVLIERLRKLAPQDIGALMDISDKLAVLN
ATRYGDWSPEFTAANSKQAVLAFNGDVYEGFDASSLSDDDLGFAQKHVRILSGLYGVLRP
LDWMQPYRLEMGTRLDNVAGKDLYAFWGDDVTQLLNDDFKAQKAEGSPALVNLASEEYFK
VVRPKVLGARIVTPVFEDWKGGRYKIISFHAKRARGFMARYAVTHRITEPAKLKRFAEHG
YAFDAAASDDARWVFRRRLED